KEGG   Citrobacter rodentium: ROD_48871
Entry
ROD_48871         CDS       T01145                                 

Gene name
nleF
Definition
(GenBank) T3SS effector protein NleF
  KO
K23658  T3SS secreted effector NleF
Organism
cro  Citrobacter rodentium
SSDB
Motif
Pfam: NleF_casp_inhib EPOP
Other DBs
NCBI-ProteinID: CBG91573
UniProt: D2TRX8
LinkDB
Position
5153487..5154065
AA seq 192 aa
MFGMLPASSSSANLYSWMYISGKENPSTPESVSELNHNHFLSPELQEKLDVMFAIYSCAR
NNDERENIYPELRDFVSSLMDKRNNVFEVINEDTDEVTGALRAGMTIEDRDSYIRDLFFL
HSLKVKIEESRQDKEDWKCKVYDLLCPHHSSELYGDLRAIKCLVEGCSDDFSPFDTIKVP
DLTYNKGSLQIG
NT seq 579 nt   +upstreamnt  +downstreamnt
atgtttggtatgttaccagctagtagctcttcagcaaatctttactcatggatgtatatc
tcaggaaaagagaatccttcgactccggaatcagtaagtgaacttaatcataatcatttt
ctttctcctgaattacaggagaaactggatgttatgttcgccatatattcatgtgccaga
aacaatgatgagcgtgagaatatttacccggagctaagggattttgtaagtagcctaatg
gataagagaaacaatgtgtttgaggtgataaatgaagatactgatgaggtgaccggagct
ctgagagcgggaatgacgatagaggacagggatagttatatcagggatcttttttttctg
cattcattgaaagtaaaaattgaggaaagcagacaagataaagaggattggaaatgtaaa
gtttatgatctgctatgtccgcatcattcttcagagctatatggggatctacgggcaatc
aaatgcctcgttgaaggatgcagtgatgattttagtccttttgatactattaaggtgccg
gatcttacttacaacaaaggatctttgcaaattggatag

DBGET integrated database retrieval system