KEGG   Citrobacter rodentium: ROD_p2421
Entry
ROD_p2421         CDS       T01145                                 
Symbol
triH
Name
(GenBank) putative conjugal transfer protein TriH
  KO
K03204  type IV secretion system protein VirB9
Organism
cro  Citrobacter rodentium
Pathway
cro03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:cro00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    ROD_p2421 (triH)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:cro02044]
    ROD_p2421 (triH)
Secretion system [BR:cro02044]
 Type IV secretion system
  Conjugal DNA-protein transfer (VirB/D) protein
   ROD_p2421 (triH)
SSDB
Motif
Pfam: CagX
Other DBs
NCBI-ProteinID: CBG91863
UniProt: D2TVE4
LinkDB
Position
pCROD2:complement(27498..28406)
AA seq 302 aa
MMKKLFIATCLLLPGLVYSAATPLPSGFDARMQTVSYNGANTTVIRSKTGFLTSVVFDEG
EAVISAKAGFPAGWEITTDDNVVYINPRPVVQEQEGDEGEKLKKVFQPTEKEWDTNLFVR
TTKRIYSLDLILLSEEKQAQPAYVVQFRYPSEIAKKNAEEVRLAKEKQEKLRQKKLISES
FEKADAPKNWDYFMRVNEKYDSRRIAPDFAYDNGIFTFLGFNSGKVFPAPFAVRDGQEQT
LAFNVETKGKYKIMVIHNVNDKFVLRYGNSVVGVVNKSFGKVLTDQRNTSSPAVERVEVN
ND
NT seq 909 nt   +upstreamnt  +downstreamnt
atgatgaagaaattatttattgctacatgtttattgcttcctgggcttgtgtattcagca
gcgactccgttaccttctggatttgatgcaaggatgcagactgtgagttataacggtgcg
aatacgaccgttatccggtcaaagacaggatttctcacatcagttgtttttgatgaaggt
gaggctgttatcagtgcaaaggctggttttcctgccggatgggaaatcacaaccgatgat
aatgttgtttacatcaatccgcgtcccgttgttcaggaacaggaaggcgatgaaggcgaa
aaactgaaaaaggttttccagccaacagaaaaggaatgggacacgaatctttttgtcaga
acaacaaagcggatttacagtcttgatctaatccttctgtcagaagaaaaacaagcgcaa
cctgcttatgttgtacaattccgctatccatcagaaatagcgaaaaagaatgcagaagaa
gtaaggctggcaaaagaaaaacaggaaaaactcagacagaagaaactgatttctgaaagt
tttgaaaaagccgatgcgcctaaaaactgggattatttcatgcgagtcaatgaaaaatat
gacagtcgtcgtatcgcccctgattttgcttatgataatggcatatttacctttttaggt
tttaactcagggaaagtattcccagctccatttgctgtaagagatggtcaggaacagaca
cttgcttttaatgtggaaacaaaaggcaagtataaaatcatggttatccacaacgttaat
gacaaatttgttttacgctatggaaacagcgttgttggtgttgtgaataaatctttcgga
aaagtattaaccgaccagaggaatacatcttctcctgcggtagaacgtgttgaggtgaat
aatgactga

DBGET integrated database retrieval system