KEGG   Citrobacter rodentium: ROD_p2451
Entry
ROD_p2451         CDS       T01145                                 
Symbol
triE
Name
(GenBank) putative conjugal transfer protein TriE
  KO
K03201  type IV secretion system protein VirB6
Organism
cro  Citrobacter rodentium
Pathway
cro03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:cro00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    ROD_p2451 (triE)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:cro02044]
    ROD_p2451 (triE)
Secretion system [BR:cro02044]
 Type IV secretion system
  Conjugal DNA-protein transfer (VirB/D) protein
   ROD_p2451 (triE)
SSDB
Motif
Pfam: TrbL RNA12
Other DBs
NCBI-ProteinID: CBG91866
UniProt: D2TVB0
LinkDB
Position
pCROD2:complement(29604..30683)
AA seq 359 aa
MSFFVKYNTTVMEAIDKVGSTYQSQFTQDIMSLVTASVTLYVLWKGYQILASKTQTPMQD
LVWDLSKFAIIIMFITNADGYLTAATNALQGMKDGLSGGVSAWQTLDNLWEKTQNLAEKV
YQKDTDFIPLAGALGMTLVWAGSLILMTISAVVFLTADITMKFLIITAPIFIFCLMFGFI
RVMFNNWLQSLFSSILTVLFASLVIRIAMDFQGDILQQVSNATPNSNVMTVSAMGFLAGL
LGALLVLIAKSFAVQLAGAGVEGAVQGAAMMGLGAAGMATGKSLMLGGRAGLGFGLGMAG
RTGMNSLSGKAGNLMGRGARTAAEWAGEKGYQALAPTGALGMKARRLASLEKARARNAA
NT seq 1080 nt   +upstreamnt  +downstreamnt
atgtcattctttgttaaatataatacaaccgttatggaagcaattgataaggttggatct
acttatcaaagtcaattcacacaagatataatgtcattagtgacagcatctgtcacgtta
tatgtactatggaaaggctatcaaatactcgccagtaaaactcagactccgatgcaggat
ttagtttgggatttatcaaaatttgcgatcataatcatgtttataacaaatgcagatgga
tatttgacagcggcaaccaatgcattgcaaggcatgaaagatgggctttctggcggagtt
agcgcatggcaaaccttagataacttatgggagaaaacacaaaatcttgcggaaaaggta
tatcaaaaagacactgatttcattcctttggctggcgcattaggtatgacgcttgtttgg
gctggctcacttattttaatgacaattagtgctgttgtttttttaactgccgatattacg
atgaaattccttattataacagcgccaatatttattttctgtctgatgtttggttttatt
agagttatgtttaataactggttgcaatcgctattttctagcatcctgactgtgttattt
gccagtttagtaattcggatagctatggattttcagggggatatattgcaacaagtatct
aatgcgacacccaatagtaatgttatgaccgtaagtgcaatgggatttttagccggattg
ttgggagctttattggttcttatagctaaaagttttgctgtccagttagcaggtgcaggt
gttgaaggtgctgttcagggcgcagccatgatggggctgggtgctgctggtatggctact
ggtaagtctctgatgcttggcggtcgcgctggtttaggttttggcttagggatggccgga
agaacgggcatgaattctttatctgggaaagcagggaatctgatggggcgtggtgcgcga
acagccgctgaatgggcgggtgaaaagggatatcaggcgctggctccgacaggtgctttg
gggatgaaggcgagaagacttgcatccctggaaaaagcacgagcgaggaatgccgcatga

DBGET integrated database retrieval system