KEGG   Citrobacter rodentium: ROD_p2481
Entry
ROD_p2481         CDS       T01145                                 
Symbol
triC
Name
(GenBank) putative conjugal transfer protein TriC
  KO
K03199  type IV secretion system protein VirB4 [EC:7.4.2.8]
Organism
cro  Citrobacter rodentium
Pathway
cro03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:cro00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    ROD_p2481 (triC)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:cro02044]
    ROD_p2481 (triC)
Enzymes [BR:cro01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.8  protein-secreting ATPase
     ROD_p2481 (triC)
Secretion system [BR:cro02044]
 Type IV secretion system
  Conjugal DNA-protein transfer (VirB/D) protein
   ROD_p2481 (triC)
SSDB
Motif
Pfam: CagE_TrbE_VirB VirB3 P-loop_TraG AAA_10 FtsK_SpoIIIE AAA_22 NACHT
Other DBs
NCBI-ProteinID: CBG91869
UniProt: D2TVB3
LinkDB
Position
pCROD2:complement(32473..35220)
AA seq 915 aa
MSTLYKAMTRPAMYVGVPVVPLTVVAGALFLAGVYISKLIWLAIPVAVFILRMITKQDDH
IFNLYFLKLKMLGNSVCNRFFGARAFLSGQYEAVEIDEFINAMKLNERITTGKYIPYSSH
VDKNIVKTKNGDYVATWQLMGINFESISAEMLETIDSQVATLVRSFSGLPVSFYNHSCRA
SFYDAFTTKSGNKYADIISDCYYGSMKKNKFKGNTLYFTLIYRPDGRVEKLEKRKKSIKE
KKDDINIHVKRMNEMINTFSGALDKFTCKLLGMYEENGKVFSSQLSFYNYLLTGKLQKIR
VTDSPVYNVLGGVDVFFNHDTGQICRIDGNKFFRSIEIKDFCSETASGVFDVLQYSDADY
IITHSYTSMSKSEALSTIKRAEKQLKSTEDDAVTQLQELEKAKNDIVSGDISFGYYHFTL
MVMADSIRELDESVSKITADFTDLGIIPALSTMSLPAAYFAQLPAVFHLRPRLSPVSNVN
FVELASFHNFYQGKRDKNCWTEAVAILKTPSKQAYYLNLHNSVLFKDERGEKNLANTKVI
GTAGSGKTMFLSYLACSLQKYNNPETFADSAKNKKLTCVFLDKDRGAELCIRMLGGEYYT
VKSGEPTGWNPFALEATKRNRIFVKQLMEILCTRNGERLSTRERLLISESVDAVMDFPPG
EMREYGITRMLEHLMQRDDRDEQENGIILRLSQWANGQAHGWVFDNAKDTFNIQHVNNFG
IDGTEFLDDPMVCAPITFYLLYRITQLLDGRRLVIFLDEFWKWLQDEAFSDFVYNKLKTI
RKLNGLVIPATQSPDEILKNKISRAVVEVCSTSIYLANPDADYNDYVEGLKLTPEEFNIV
KNLDPMSRQFLIKKSSLKKGDGKSFSALATLDLSGLGGYLKILSASADNLEIFESIYHEG
MEPDDWVPEYLERAI
NT seq 2748 nt   +upstreamnt  +downstreamnt
atgtctacactttataaagcgatgacacgccctgctatgtatgtgggtgttcctgtcgtc
cctcttactgtggttgcaggggcgttatttctggcgggggtttatatcagcaagctgatc
tggctggctattcctgtcgcagtttttattctcagaatgataactaagcaggacgaccac
atttttaatctttactttcttaagctgaaaatgctcggaaactcagtgtgtaatcgtttt
tttggcgcacgagcgttcctctccggacaatatgaagctgttgaaattgatgagtttatt
aatgccatgaaactgaatgagcgaattactactggtaaatatataccctattcaagccat
gttgataaaaatattgtcaaaacaaagaacggtgattatgtagcgacatggcaactgatg
gggattaactttgagtcaatctctgcggagatgttagaaactattgactcacaggttgcc
actcttgttcgttcattttccggactgcccgtttcattttataaccattcatgcagggcg
agtttttatgatgcctttaccacaaaatcaggtaataaatatgctgatataatatcagat
tgttattatggttcgatgaagaaaaataaattcaaggggaacacactttactttacgctg
atctacagaccagacgggcgtgtagaaaaactggaaaaacgcaaaaaaagtattaaagaa
aagaaagatgatattaacattcatgtgaagagaatgaatgaaatgattaatacattctct
ggcgctcttgataaatttacctgtaaacttcttggtatgtatgaggagaacggaaaggta
ttttcttctcaactgtcattctataattatcttctgacagggaagttgcaaaaaatcaga
gtcactgattctccggtgtataacgttcttggtggagtggatgtattttttaatcatgat
accggacagatatgccgcattgatggaaataaattctttcgttctattgaaattaaagat
ttctgtagtgagactgcatccggtgtttttgatgtgctccagtattctgatgctgactat
attattacgcattcatatacatccatgagcaaatcagaagcattgagtaccattaaacgt
gcagaaaaacagttaaagagtacagaagatgatgcggttactcaattgcaggaactggaa
aaggcaaaaaatgatattgtgtccggtgatatatcctttggttactaccatttcacgcta
atggtaatggcggacagtatcagggagcttgacgaatctgtaagtaaaattacggcagac
tttactgacctgggcattattccggcattgtcaaccatgtcattgccagcggcatatttt
gcccagcttccggcggtttttcatttaaggccgcgtttatctccggtatcgaatgtaaat
tttgtcgaactggcatcattccataatttctaccaggggaaacgcgataaaaactgctgg
acagaagcggttgctattctcaaaacaccaagcaaacaggcgtattatctgaatttacat
aactcagtactgtttaaagatgaaagaggtgaaaagaatcttgctaatactaaagttata
ggaacggcgggttcaggtaagacaatgtttctgtcatatcttgcctgttcattacagaaa
tacaataaccccgaaacttttgctgactctgcaaaaaataagaagttaacgtgtgtcttt
cttgataaggacagaggggctgaattatgtatccgaatgcttggtggggaatattacacc
gtaaaaagcggtgagccgacaggatggaatccttttgctctggaggcaacaaaacgtaac
cgtatttttgtcaagcaactgatggagattctgtgtaccagaaatggtgaaagattatcg
acaagagaaagattgcttattagcgaaagtgttgatgctgtgatggattttcctcctggc
gaaatgcgggaatatggcattaccagaatgcttgagcatcttatgcagagagatgatcgg
gatgagcaggagaacgggattatccttcgtttgtcccaatgggctaatggtcaggctcat
ggctgggtttttgataatgctaaagacacattcaatattcagcatgtcaataattttggc
attgatggcaccgagtttcttgatgatccgatggtatgtgcaccaattactttctatctg
ctgtatcgcattacgcagcttctggacggtcggcgtcttgttatcttcctggatgagttc
tggaaatggctacaggatgaagcattcagcgattttgtctataacaagctgaaaacaatt
cgtaagctgaacgggctggttattccggcaactcagtctccggatgaaatactgaagaat
aagatttcacgggctgtggttgaagtatgcagcaccagtatttatctggctaaccctgat
gccgattacaatgactatgtagaagggcttaagctgacaccagaagaatttaatattgtt
aaaaatcttgatccaatgtcgagacaattcctgattaaaaaaagcagtcttaaaaaggga
gatggtaaatcattttcagcacttgcgacactcgatttatcgggacttggtggatatctg
aaaatattgtctgccagtgcagataatctggaaatttttgaaagtatttatcatgaagga
atggagcctgatgactgggttcctgaatatctcgaacgggcaatctga

DBGET integrated database retrieval system