KEGG   Citrobacter rodentium: ROD_p2491
Entry
ROD_p2491         CDS       T01145                                 
Symbol
triB
Name
(GenBank) putative conjugal transfer protein TriB
  KO
K03197  type IV secretion system protein VirB2
Organism
cro  Citrobacter rodentium
Pathway
cro03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:cro00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    ROD_p2491 (triB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:cro02044]
    ROD_p2491 (triB)
Secretion system [BR:cro02044]
 Type IV secretion system
  Conjugal DNA-protein transfer (VirB/D) protein
   ROD_p2491 (triB)
SSDB
Motif
Pfam: TrbC T4SS_pilin
Other DBs
NCBI-ProteinID: CBG91870
UniProt: D2TVB4
LinkDB
Position
pCROD2:complement(35239..35565)
AA seq 108 aa
MSFKKSVCNRISSSVTAVMQRKNKVVMAVAGATVASPAFADGFSKAETLLEKVKTGLSGL
SLVTVTIACLWVGYKVLFGGSTIRECSPIIIGAIVIASAAEVASMMVN
NT seq 327 nt   +upstreamnt  +downstreamnt
atgtcatttaagaaatcagtatgtaatcgtatcagttcatctgtcactgctgttatgcag
cgtaaaaataaggtagttatggcagtcgccggggcaacagtcgcatcaccagcctttgcg
gatggattttcaaaagcggaaacactgctggaaaaggtcaaaacagggcttagtggcctt
tcactggtcacggtgactattgcctgtctgtgggtcggctacaaggttctgtttggtgga
agcacgattcgtgaatgctcacctatcatcatcggggcaattgttatcgccagtgcggct
gaagttgcatcaatgatggttaactaa

DBGET integrated database retrieval system