Crossiella sp. CA-258035: N8J89_20285 Help Entry N8J89_20285       CDS       T09057                                  Name (GenBank) acyl carrier protein   KO K05553   minimal PKS acyl carrier protein Organism cros  Crossiella sp. CA-258035 Pathway cros00253   Tetracycline biosynthesis cros01056   Biosynthesis of type II polyketide backbone cros01100   Metabolic pathways cros01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:cros00001]  09100 Metabolism   09109 Metabolism of terpenoids and polyketides    01056 Biosynthesis of type II polyketide backbone     N8J89_20285    00253 Tetracycline biosynthesis     N8J89_20285  09180 Brite Hierarchies   09181 Protein families: metabolism    01004 Lipid biosynthesis proteins [BR:cros01004]     N8J89_20285    01008 Polyketide biosynthesis proteins [BR:cros01008]     N8J89_20285 Lipid biosynthesis proteins [BR:cros01004]  Polyketide synthase   Component type    N8J89_20285 Polyketide biosynthesis proteins [BR:cros01008]  Polyketide synthase (PKS)   Type II PKS    C7-C14 cyclized polyketide type     Octaketide PKS      N8J89_20285     Nonaketide PKS      N8J89_20285     Decaketide PKS      N8J89_20285 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  WHT23323 LinkDB All DBs Position 4470033..4470299 Genome browser AA seq 88 aa AA seqDB search MSELTLRRLMEVMRDCAGDGEGVDLDGDIQDRSFDDLGYDSLARLETAAKLERDLGIRLP DEEVTEAMTPRDFLALVNESRSSTGTGG NT seq 267 nt NT seq  +upstreamnt  +downstreamnt atgagcgagctgacgcttcgacggctcatggaggtcatgcgcgactgcgcgggtgacggc gagggtgtggacctcgacggggacatccaggaccgcagcttcgacgacctcggctacgac tccctcgcgcggctggagaccgcggccaagctggaacgcgacctcggcatccgcctgccg gacgaggaggtcaccgaggccatgacgccaagggacttcctcgcactcgtcaacgagagc cgctcgtcgaccggcaccggtggatga

DBGET integrated database retrieval system