Caenorhabditis remanei (nematode): GCK72_000152 Help Entry GCK72_000152      CDS       T09085                                  Name (RefSeq) hypothetical protein   KO K10420   dynein light chain Tctex-type 1/3 Organism crq  Caenorhabditis remanei (nematode) Pathway crq04814   Motor proteins Brite KEGG Orthology (KO) [BR:crq00001]  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     GCK72_000152  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:crq03037]     GCK72_000152    04812 Cytoskeleton proteins [BR:crq04812]     GCK72_000152 Cilium and associated proteins [BR:crq03037]  Motile cilia and associated proteins   Dynein arm    GCK72_000152 Cytoskeleton proteins [BR:crq04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      GCK72_000152 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Tctex-1 Motif Other DBs NCBI-GeneID:  9822661 NCBI-ProteinID:  XP_003093362 UniProt:  E3NE14 LinkDB All DBs Position I:1167195..1169368 Genome browser AA seq 106 aa AA seqDB search MALPEEDVHMIIKQVLDETVGANATYTHKDSVQWNQKAVEQITKKLVAAGKPYKYVVTSS FLQISSGSGLNVSTISYWNKVTDFSYMYRWEAKTMLAIVYVFAIAI NT seq 321 nt NT seq  +upstreamnt  +downstreamnt atggctctcccagaggaagatgttcatatgatcataaagcaggttctcgacgagacggtt ggtgcgaacgcgacatacacccacaaagacagtgtccaatggaatcagaaggccgtcgag cagataacgaagaagttggtcgccgccggcaaaccgtacaaatacgtcgtcacctcgtcg tttttgcaaatttccagcggttccggactgaatgttagcaccatttcctactggaataag gtcaccgatttctcgtacatgtaccgatgggaagcgaaaaccatgttggcaatcgtctac gtcttcgccatcgcaatctaa

DBGET integrated database retrieval system