Caenorhabditis remanei (nematode): GCK72_001277 Help Entry GCK72_001277      CDS       T09085                                  Name (RefSeq) hypothetical protein   KO K03094   S-phase kinase-associated protein 1 Organism crq  Caenorhabditis remanei (nematode) Pathway crq03083   Polycomb repressive complex crq04120   Ubiquitin mediated proteolysis crq04141   Protein processing in endoplasmic reticulum crq04310   Wnt signaling pathway crq04350   TGF-beta signaling pathway Brite KEGG Orthology (KO) [BR:crq00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     GCK72_001277    04120 Ubiquitin mediated proteolysis     GCK72_001277   09126 Chromosome    03083 Polycomb repressive complex     GCK72_001277  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     GCK72_001277    04350 TGF-beta signaling pathway     GCK72_001277  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:crq04131]     GCK72_001277    04121 Ubiquitin system [BR:crq04121]     GCK72_001277    03036 Chromosome and associated proteins [BR:crq03036]     GCK72_001277 Membrane trafficking [BR:crq04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     GCK72_001277 Ubiquitin system [BR:crq04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      GCK72_001277    Cul7 complex      GCK72_001277 Chromosome and associated proteins [BR:crq03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      GCK72_001277   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      GCK72_001277 SSDB OrthologParalogGFIT Motif Pfam:  Skp1_POZ Skp1 CRISPR_Cas6_N AF_0136_C Motif Other DBs NCBI-GeneID:  9801558 NCBI-ProteinID:  XP_003111260 UniProt:  E3LXG2 LinkDB All DBs Position I:complement(<6744210..>6744653) Genome browser AA seq 147 aa AA seqDB search MLKVKTSDDKLIEIGHNVIQRSKTLSDVFHNSKGDSNAIYSLATINSNAVYLIIEWCEHH KDVPIPAEEQCEWEFTDFDKNFFESLVDGEAFQVVTASSILDMKSLMGAGCKYIANLAKG KSPDELRLVYGIPTDSDDDEQHSIRMQ NT seq 444 nt NT seq  +upstreamnt  +downstreamnt atgttgaaagtgaagacttctgacgacaaattgattgaaatcggccacaatgtgatccaa agatcgaaaactctcagcgatgtatttcacaacagcaaaggagattcaaatgctatatat tcattggcaacaataaattcaaatgcagtctatctcattatcgaatggtgcgaacaccac aaagatgttccgattcctgccgaagaacagtgcgagtgggaatttactgacttcgacaag aacttttttgaaagcctggttgatggagaagctttccaagtcgtcactgcttcctctatc ttggatatgaagagtctaatgggtgctggatgtaaatatatcgctaatttggcaaaaggc aaatctccggatgaattgagactcgtgtacggaatcccaactgattcagatgatgacgaa caacattctatcaggatgcagtaa

DBGET integrated database retrieval system