Caenorhabditis remanei (nematode): GCK72_005502 Help Entry GCK72_005502      CDS       T09085                                  Name (RefSeq) hypothetical protein   KO K03014   DNA-directed RNA polymerases I, II, and III subunit RPABC2 Organism crq  Caenorhabditis remanei (nematode) Pathway crq03020   RNA polymerase crq03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:crq00001]  09120 Genetic Information Processing   09121 Transcription    03020 RNA polymerase     GCK72_005502   09124 Replication and repair    03420 Nucleotide excision repair     GCK72_005502  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:crq03021]     GCK72_005502    03400 DNA repair and recombination proteins [BR:crq03400]     GCK72_005502 Transcription machinery [BR:crq03021]  Eukaryotic type   RNA polymerase II system    RNA polymerase II     Pol I, II, III common subunits      GCK72_005502   RNA polymerase III system    RNA polymerase III      GCK72_005502   RNA polymerase I system    RNA polymerase I      GCK72_005502 DNA repair and recombination proteins [BR:crq03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     TCR (transcription coupled repair) factors      DNA-directed RNA polymerase II complex       GCK72_005502 SSDB OrthologParalogGFIT Motif Pfam:  RNA_pol_Rpb6 Motif Other DBs NCBI-GeneID:  9822371 NCBI-ProteinID:  XP_003116742 UniProt:  E3LFP4 LinkDB All DBs Position II:complement(<9069175..>9069588) Genome browser AA seq 137 aa AA seqDB search MADDDDYQDMDNDDFVDDNDMEDVIEEDPQRADNEDEDDDNVDENFELFDQGKAVPTSEH VTTPFMTKYERARVLGTRALQIAMGAPVMVELEGETDPLEIARKELKQRRIPIIIRRYLP DGSYEDWPTEQLQLADW NT seq 414 nt NT seq  +upstreamnt  +downstreamnt atggccgatgatgatgattaccaagatatggacaacgatgactttgtggacgacaatgat atggaagatgtgattgaggaagacccacaacgtgcggataatgaggatgaggacgatgat aatgtcgatgagaacttcgagttattcgatcaaggaaaagctgttccgaccagtgaacat gtaacaactccgttcatgacaaaatatgaacgtgctcgtgttcttggaactcgtgctctt caaattgctatgggtgctccagtgatggttgagctcgaaggagagactgatccacttgag attgctagaaaagagctcaagcaacgtcgcatccctatcatcattcgtcgttatcttcca gatggctcctacgaagactggccaaccgagcaactccaacttgctgattggtag

DBGET integrated database retrieval system