Caenorhabditis remanei (nematode): GCK72_006234 Help Entry GCK72_006234      CDS       T09085                                  Name (RefSeq) hypothetical protein   KO K08341   GABA(A) receptor-associated protein Organism crq  Caenorhabditis remanei (nematode) Pathway crq04068   FoxO signaling pathway crq04136   Autophagy - other crq04137   Mitophagy - animal crq04140   Autophagy - animal crq04145   Phagocytosis crq04156   Integrated stress response (ISR) signaling pathway crq04212   Longevity regulating pathway - worm Brite KEGG Orthology (KO) [BR:crq00001]  09130 Environmental Information Processing   09132 Signal transduction    04068 FoxO signaling pathway     GCK72_006234  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagocytosis     GCK72_006234    04140 Autophagy - animal     GCK72_006234    04136 Autophagy - other     GCK72_006234    04137 Mitophagy - animal     GCK72_006234   09143 Cell growth and death    04156 Integrated stress response (ISR) signaling pathway     GCK72_006234  09150 Organismal Systems   09149 Aging    04212 Longevity regulating pathway - worm     GCK72_006234  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:crq04131]     GCK72_006234    04121 Ubiquitin system [BR:crq04121]     GCK72_006234    03029 Mitochondrial biogenesis [BR:crq03029]     GCK72_006234 Membrane trafficking [BR:crq04131]  Autophagy   Autophagosome formation proteins    Atg8 conjugation proteins     GCK72_006234 Ubiquitin system [BR:crq04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitin-like proteins (UBLs)    GCK72_006234 Mitochondrial biogenesis [BR:crq03029]  Mitochondrial quality control factors   Mitophagy factors    Autophagy-related proteins     GCK72_006234 SSDB OrthologParalogGFIT Motif Pfam:  ATG8 APG12 NRG4_TM Motif Other DBs NCBI-GeneID:  9811260 NCBI-ProteinID:  XP_003113753 UniProt:  E3LR71 LinkDB All DBs Position II:complement(<11843635..>11844066) Genome browser AA seq 123 aa AA seqDB search MKWAYKEENNFEKRRAEGDKIRRKYPDRIPVIVEKAPKSRLRDLDKKKYLVPSDLTVGQF YFLIRKRIQLRPEDALFFFVNNVIPQTMTTMGQLYQDHHEEDLFLYIAYSDESVYGGEVE KKE NT seq 372 nt NT seq  +upstreamnt  +downstreamnt atgaagtgggcatacaaggaggagaacaacttcgagaagcgtcgtgctgaaggagacaag attcgcagaaagtacccagaccgtattccagttattgttgagaaggcaccaaaatcgaga ctccgtgatttggacaagaagaagtacttggttccatcggacttgactgtgggacagttc tatttcctcatccgcaagcgtattcaactccgtcctgaagatgctctcttcttcttcgtc aacaacgtcatcccacaaaccatgacaacgatgggccaactctaccaggaccatcacgag gaggacctgttcctttacatcgcctacagtgacgagagtgtatacggaggagaggtcgag aagaaggagtag

DBGET integrated database retrieval system