Caenorhabditis remanei (nematode): GCK72_009108 Help Entry GCK72_009108      CDS       T09085                                  Name (RefSeq) hypothetical protein   KO K17771   mitochondrial import receptor subunit TOM7 Organism crq  Caenorhabditis remanei (nematode) Pathway crq04137   Mitophagy - animal Brite KEGG Orthology (KO) [BR:crq00001]  09140 Cellular Processes   09141 Transport and catabolism    04137 Mitophagy - animal     GCK72_009108  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:crq04131]     GCK72_009108    03029 Mitochondrial biogenesis [BR:crq03029]     GCK72_009108   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:crq02000]     GCK72_009108 Membrane trafficking [BR:crq04131]  Autophagy   Mitophagy    Other mitophagy associated  proteins     GCK72_009108 Mitochondrial biogenesis [BR:crq03029]  Mitochondrial protein import machinery   Outer membrane    Transporter outer membrane (TOM) complex     GCK72_009108 Transporters [BR:crq02000]  Other transporters   Primary active transporters [TC:3]    GCK72_009108 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Tom7 Motif Other DBs NCBI-GeneID:  9818270 NCBI-ProteinID:  XP_053586795 UniProt:  A0A6A5H0R6 LinkDB All DBs Position III:complement(4844777..4845291) Genome browser AA seq 85 aa AA seqDB search MKLSPATKSFLGKTIDVSTFAIQWGFVPFVVYLGFKKGAEPMPNGQRKRNKIKPLLPSMW LSNANKSSKMTEICANVAHHIELER NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atgaagctctcgccagccaccaaatcgttcctcggcaagaccatcgatgtctccacattc gccattcagtggggattcgtgccgttcgttgtctacctcggattcaagaagggtgccgag ccaatgccaaatggacagaggaaaagaaataaaattaaaccgcttttgccatcgatgtgg ttgagcaacgcgaacaaatcatcgaaaatgactgagatttgcgccaacgtggctcaccac atcgaattggagcgttga

DBGET integrated database retrieval system