Caenorhabditis remanei (nematode): GCK72_012273 Help Entry GCK72_012273      CDS       T09085                                  Name (RefSeq) hypothetical protein   KO K10418   dynein light chain LC8-type Organism crq  Caenorhabditis remanei (nematode) Pathway crq04814   Motor proteins Brite KEGG Orthology (KO) [BR:crq00001]  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     GCK72_012273  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:crq03037]     GCK72_012273    04812 Cytoskeleton proteins [BR:crq04812]     GCK72_012273 Cilium and associated proteins [BR:crq03037]  Motile cilia and associated proteins   Dynein arm    GCK72_012273 Cytoskeleton proteins [BR:crq04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      GCK72_012273 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Dynein_light VapB Motif Other DBs NCBI-GeneID:  78775421 NCBI-ProteinID:  XP_053583747 UniProt:  A0A6A5GMH5 LinkDB All DBs Position IV:2650078..2650498 Genome browser AA seq 100 aa AA seqDB search MMKINGFGKKMTAKQLRTKFERQDSCDESYFDELKESRKWREPPEKAFRFENLIIQETNL PLEQTEESKKMLGDALQLCGIENEIASFMKRKFDAKYGKD NT seq 303 nt NT seq  +upstreamnt  +downstreamnt atgatgaaaatcaatggattcggtaaaaagatgactgcgaaacagttgagaacaaaattt gaaagacaagattcgtgtgatgagtcttattttgatgaattaaaagaatcccgtaaatgg cgtgaaccaccagagaaggcatttcgtttcgagaatctcataattcaagagacaaatctc ccattggaacaaactgaagaatcgaagaaaatgttgggtgatgcattgcagttatgtggc attgagaatgaaattgccagtttcatgaagaggaaatttgatgccaaatatggtaaggat taa

DBGET integrated database retrieval system