Caenorhabditis remanei (nematode): GCK72_012379 Help Entry GCK72_012379      CDS       T09085                                  Name (RefSeq) hypothetical protein   KO K04513   Ras homolog gene family, member A Organism crq  Caenorhabditis remanei (nematode) Pathway crq04081   Hormone signaling crq04144   Endocytosis crq04150   mTOR signaling pathway crq04310   Wnt signaling pathway crq04350   TGF-beta signaling pathway crq04361   Axon regeneration crq05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:crq00001]  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     GCK72_012379    04350 TGF-beta signaling pathway     GCK72_012379    04150 mTOR signaling pathway     GCK72_012379   09133 Signaling molecules and interaction    04081 Hormone signaling     GCK72_012379  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     GCK72_012379  09150 Organismal Systems   09158 Development and regeneration    04361 Axon regeneration     GCK72_012379  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     GCK72_012379  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:crq04131]     GCK72_012379   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:crq04147]     GCK72_012379    04031 GTP-binding proteins [BR:crq04031]     GCK72_012379 Membrane trafficking [BR:crq04131]  Endocytosis   Lipid raft mediated endocytosis    RhoA-dependent endocytosis     GCK72_012379 Exosome [BR:crq04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    GCK72_012379   Exosomal proteins of other body fluids (saliva and urine)    GCK72_012379   Exosomal proteins of colorectal cancer cells    GCK72_012379   Exosomal proteins of bladder cancer cells    GCK72_012379 GTP-binding proteins [BR:crq04031]  Small (monomeric) G-proteins   Rho Family    RhoA/B/C [OT]     GCK72_012379 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Gtr1_RagA MMR_HSR1 PAC1 HGTP_anticodon Glyco_hydro_72 Motif Other DBs NCBI-GeneID:  9803931 NCBI-ProteinID:  XP_053583836 UniProt:  A0A6A5GMZ5 LinkDB All DBs Position IV:3951064..3953885 Genome browser AA seq 200 aa AA seqDB search MGHPEKTVHDIRKKLVVVGDGACGKTSLLIVFSKNQFPEAYVPTVFDTDSIDIEVDGKYV QLDLWDTAGQEDYERLRPLSYPETHIILICFSIDFPDSLENVIEKWTPEIKHFCPKVPFL LVGNKKDLRDDEETLRELEKKRQVPVKYEQGVEVAQRIGAVGYFECSAKSKEGVKEIFDV AVRETLRKQKKPKPQFCKIL NT seq 603 nt NT seq  +upstreamnt  +downstreamnt atgggtcacccggagaaaactgttcatgacattcgcaagaagctcgtggtggttggtgat ggtgcctgtgggaagacctctcttttgatcgtgtttagtaagaaccagtttccagaagca tacgtgccgacggtatttgacacggactcgattgatatagaggtcgatgggaaatatgtc caactagacctatgggacactgctggacaagaggactacgagaggctccgcccactttcc tacccggaaactcatatcattcttatctgtttctcaatcgacttccctgattccctggaa aatgtcattgagaaatggacccccgagatcaaacacttctgcccgaaagtgccgttctta ctggttggaaataagaaagatttgagggacgatgaagagacgctgagagaattagagaaa aaaagacaggtacctgtgaagtatgaacaaggagtggaagttgctcaaaggattggagca gttgggtattttgagtgctccgcgaagagtaaggagggagtcaaggagatcttcgatgta gcggttcgagagacactccgaaagcagaaaaagccaaaaccacaattttgtaaaattttg tga

DBGET integrated database retrieval system