Caenorhabditis remanei (nematode): GCK72_013134 Help Entry GCK72_013134      CDS       T09085                                  Name (RefSeq) hypothetical protein   KO K08512   vesicle-associated membrane protein 8 Organism crq  Caenorhabditis remanei (nematode) Pathway crq04130   SNARE interactions in vesicular transport crq04140   Autophagy - animal crq04142   Lysosome biogenesis Brite KEGG Orthology (KO) [BR:crq00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04130 SNARE interactions in vesicular transport     GCK72_013134  09140 Cellular Processes   09141 Transport and catabolism    04142 Lysosome biogenesis     GCK72_013134    04140 Autophagy - animal     GCK72_013134  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:crq04131]     GCK72_013134 Membrane trafficking [BR:crq04131]  SNARE   VAMP, Ykt6, Sec22 (R)    VAMP     GCK72_013134 SSDB OrthologParalogGFIT Motif Pfam:  Synaptobrevin MFS_Mycoplasma YomK EVI2A PMD1-like Amnionless RhopH3_C Fzo_mitofusin MRAP YALI Motif Other DBs NCBI-GeneID:  78775733 NCBI-ProteinID:  XP_053584442 LinkDB All DBs Position IV:<10305400..>10305995 Genome browser AA seq 114 aa AA seqDB search MENDNSNKKNDNVQQQEKMQNLRNQVDSVKAVMVDNVERILERGERLDNIERRTEQLNAT SANFKFTARKVQRKFCMLNAKWTIILAIVILIVFTVLLLLILHWTGVIGKRNND NT seq 345 nt NT seq  +upstreamnt  +downstreamnt atggaaaacgacaacagtaacaagaaaaacgacaatgtccaacaacaagagaaaatgcag aatttgaggaatcaagtggattctgttaaagcggtgatggtggacaacgtggaacgaatt ctggaacgaggagagcgattagacaatatcgagagaagaacagagcagttgaatgcgacg agtgccaatttcaaattcaccgcccgtaaagtgcaacgaaagttttgtatgttgaatgcg aaatggacaattattctggcaatcgtcattcttatcgtattcaccgtactccttcttctc attcttcattggactggagtcattggaaagaggaataatgattga

DBGET integrated database retrieval system