Caenorhabditis remanei (nematode): GCK72_013278 Help Entry GCK72_013278      CDS       T09085                                  Name (RefSeq) hypothetical protein   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism crq  Caenorhabditis remanei (nematode) Pathway crq04145   Phagosome crq04148   Efferocytosis crq04310   Wnt signaling pathway crq04361   Axon regeneration crq04620   Toll-like receptor signaling pathway crq05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:crq00001]  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     GCK72_013278  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     GCK72_013278    04148 Efferocytosis     GCK72_013278  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     GCK72_013278   09158 Development and regeneration    04361 Axon regeneration     GCK72_013278  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     GCK72_013278  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:crq04131]     GCK72_013278   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:crq04147]     GCK72_013278    04031 GTP-binding proteins [BR:crq04031]     GCK72_013278 Membrane trafficking [BR:crq04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     GCK72_013278  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     GCK72_013278   Macropinocytosis    Ras GTPases     GCK72_013278  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     GCK72_013278 Exosome [BR:crq04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    GCK72_013278   Exosomal proteins of other body fluids (saliva and urine)    GCK72_013278   Exosomal proteins of colorectal cancer cells    GCK72_013278   Exosomal proteins of bladder cancer cells    GCK72_013278 GTP-binding proteins [BR:crq04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     GCK72_013278 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Motif Other DBs NCBI-GeneID:  9820123 NCBI-ProteinID:  XP_053584542 UniProt:  A0A6A5GQC1 LinkDB All DBs Position IV:11267523..11269083 Genome browser AA seq 191 aa AA seqDB search MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGRPINLGLWDTAG QEDYDRLRPLSYPQTDVFLVCFALNNPASFENVRAKWYPEVSHHCPNTPIILVGTKADLR EDRDTVERLRERRLQPVSQTQGYVMAKEIKAVKYLECSALTQRGLKQVFDEAIRAVLTPP QRAKKSKCTVL NT seq 576 nt NT seq  +upstreamnt  +downstreamnt atgcaagcgatcaaatgtgtcgtcgtcggtgacggagctgtcggtaagacgtgtctcctc atctcgtacacgacgaatgcattccccggagagtatatcccaacggtcttcgacaactat tcagcaaacgtgatggtagacggacggccgataaaccttggactttgggatacagctgga caagaagattacgatcgactccgcccactgtcctacccacaaaccgacgtgtttctcgtg tgtttcgccctgaacaatccagcgagtttcgagaatgttcgtgcgaaatggtatccagaa gtgtcacatcattgtccgaatacgccgatcatccttgtcggaacgaaagctgatttgaga gaggatcgcgacactgttgagagactccgcgaacgccgcctccaaccagtcagtcaaacg cagggatatgtgatggcgaaggagatcaaagcagtcaaatatcttgagtgttccgccctg acacaacgtggtctgaaacaagtcttcgacgaagcgatccgtgccgtcctcacgccgcca caaagagcaaagaagagcaagtgtactgtactctag

DBGET integrated database retrieval system