Caenorhabditis remanei (nematode): GCK72_014241 Help Entry GCK72_014241      CDS       T09085                                  Name (RefSeq) hypothetical protein   KO K10418   dynein light chain LC8-type Organism crq  Caenorhabditis remanei (nematode) Pathway crq04145   Phagocytosis crq04517   IgSF CAM signaling crq04814   Motor proteins Brite KEGG Orthology (KO) [BR:crq00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     GCK72_014241  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagocytosis     GCK72_014241   09142 Cell motility    04814 Motor proteins     GCK72_014241  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:crq03037]     GCK72_014241    04812 Cytoskeleton proteins [BR:crq04812]     GCK72_014241 Cilium and associated proteins [BR:crq03037]  Motile cilia and associated proteins   Dynein arm    GCK72_014241 Cytoskeleton proteins [BR:crq04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      GCK72_014241 SSDB OrthologParalogGFIT Motif Pfam:  Dynein_light GRXCR1-2_C Motif Other DBs NCBI-GeneID:  9806810 NCBI-ProteinID:  XP_003097156 UniProt:  E3N328 A0A261AL12 LinkDB All DBs Position IV Genome browser AA seq 90 aa AA seqDB search MSEEKIEVKETDMEDSQRDMVISVVREAQRLYNIDKDVAAFVKEELDKKFGATWHVICGK CFGSRVSYEMGHFILLKCNKVNVMIYKCGY NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgtcggaagagaaaatagaagtgaaagagacggatatggaggattctcaacgagatatg gtaatttctgttgttcgagaggctcaacgtctctataatatcgataaagatgtggctgca ttcgtgaaagaagagctcgataagaagtttggagccacgtggcatgtcatctgtggaaag tgtttcggaagtcgtgtcagttatgaaatgggacattttatacttctaaagtgcaataag gtgaatgtgatgatctacaagtgcggatactaa

DBGET integrated database retrieval system