Clostridium felsineum DSM 7320: CROST_037310 Help Entry CROST_037310      CDS       T08192                                  Symbol atpE Name (GenBank) ATP synthase subunit c   KO K02110   F-type H+-transporting ATPase subunit c Organism crw  Clostridium felsineum DSM 7320 Pathway crw00190   Oxidative phosphorylation crw01100   Metabolic pathways Module crw_M00157   F-type ATPase, prokaryotes and chloroplasts Brite KEGG Orthology (KO) [BR:crw00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     CROST_037310 (atpE)  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:crw00194]     CROST_037310 (atpE) Photosynthesis proteins [BR:crw00194]  Photosystem and electron transport system   F-type ATPase [OT]    CROST_037310 (atpE) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ATP-synt_C Motif Other DBs NCBI-ProteinID:  URZ12981 UniProt:  A0A1S8LQ19 LinkDB All DBs Position complement(4049608..4049856) Genome browser AA seq 82 aa AA seqDB search MNIDSTTFLHGMNAIGAGLAAIGCIGGGVGIGSVTGKAVEAIGRQPESASKVMPTMIMGL AFAEVTSLYALFVAIMLLFVIR NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atgaatattgattctactacttttttacatggaatgaatgctattggtgcaggtttagca gcaattggatgtattggtggaggtgtcggtataggttcagttacaggtaaggctgttgaa gctattggaaggcaaccagaatcagcatcaaaagttatgcctacaatgataatgggttta gcatttgctgaagttacatcattatatgctttatttgttgctataatgttattattcgtt ataagataa

DBGET integrated database retrieval system