Campylobacter rectus: CRECT_1036 Help Entry CRECT_1036        CDS       T06768                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism crx  Campylobacter rectus Pathway crx01100   Metabolic pathways crx01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:crx00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     CRECT_1036    00074 Mycolic acid biosynthesis     CRECT_1036   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     CRECT_1036 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 DUF1493 Motif Other DBs NCBI-ProteinID:  QCD46702 UniProt:  A0A6G5QM93 LinkDB All DBs Position 1111797..1112048 Genome browser AA seq 83 aa AA seqDB search MKQEEIFEILKSALMQLFEIEESKITPQTRIYEDLQIDSIDAIDLIDHIKRKTGHRLMPE DFKNVKTLEDIVNAVAKKFDEQA NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atgaagcaggaagaaatttttgagattttaaagtccgcgctcatgcagctttttgagata gaggagtccaaaatcacgccgcaaacgcgcatttacgaggatttgcagatagatagcatc gatgcgatcgatcttatcgatcatatcaagcgcaaaacgggccaccgattgatgcctgaa gactttaaaaacgtaaaaacgctcgaagacatcgtaaacgcggtggctaaaaaatttgac gagcaagcttaa

DBGET integrated database retrieval system