Campylobacter rectus: CRECT_1296 Help Entry CRECT_1296        CDS       T06768                                  Symbol hup Name (GenBank) DNA-binding protein HU   KO K03530   DNA-binding protein HU-beta Organism crx  Campylobacter rectus Brite KEGG Orthology (KO) [BR:crx00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:crx03032]     CRECT_1296 (hup)    03036 Chromosome and associated proteins [BR:crx03036]     CRECT_1296 (hup)    03400 DNA repair and recombination proteins [BR:crx03400]     CRECT_1296 (hup) DNA replication proteins [BR:crx03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     CRECT_1296 (hup) Chromosome and associated proteins [BR:crx03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     CRECT_1296 (hup) DNA repair and recombination proteins [BR:crx03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       CRECT_1296 (hup) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_bac_2 HU-CCDC81_euk_1 GST_C_2 Motif Other DBs NCBI-ProteinID:  QCD46951 UniProt:  A0A6G5QMT4 LinkDB All DBs Position 1419310..1419612 Genome browser AA seq 100 aa AA seqDB search MKKADFIQAVAEKAGLSKKDSLKVVDAALEVIESALVAGDSVSFIGFGTFGTADRAARKA RVPGTKKVIDVPASKAVKFKVGKKLKEAVVAGAGKKCKKK NT seq 303 nt NT seq  +upstreamnt  +downstreamnt atgaaaaaagctgattttattcaagctgttgccgaaaaggctggtctttctaaaaaagat tctctaaaagtcgttgatgcggcgttagaagtaatcgaaagcgcattagtcgcaggagat agcgttagctttataggttttggtacattcggcacagccgacagagctgctagaaaagca agagtacccggaactaaaaaagttatcgacgttcctgctagcaaagctgttaaatttaaa gtaggcaaaaaactaaaagaagccgtagtagccggtgcaggcaaaaaatgtaaaaagaaa taa

DBGET integrated database retrieval system