Cryobacterium sp. LW097: B7495_08520 Help Entry B7495_08520       CDS       T04908                                  Name (GenBank) hypothetical protein   KO K03116   sec-independent protein translocase protein TatA Organism cry  Cryobacterium sp. LW097 Pathway cry03060   Protein export cry03070   Bacterial secretion system Brite KEGG Orthology (KO) [BR:cry00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     B7495_08520  09130 Environmental Information Processing   09131 Membrane transport    03070 Bacterial secretion system     B7495_08520  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:cry02044]     B7495_08520 Secretion system [BR:cry02044]  Twin-arginine translocation (Tat) system   Twin-arginine translocation (Tat) pathway protein    B7495_08520 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  TatA_B_E Motif Other DBs NCBI-ProteinID:  ASD22133 UniProt:  A0AAC9X4I7 LinkDB All DBs Position complement(1851087..1851329) Genome browser AA seq 80 aa AA seqDB search MLSNLTGWHFLIILVVILLLFGAPKLPGLARSLGQSMKIFKNEIKSDTVDEPADKTGTPA HPDAADGTTRTVGPGDQTKS NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atgttgagcaatctgaccggatggcactttctgatcatcctcgtcgtcatcctgctgttg ttcggtgcgcccaagctgcccggcctggcccgcagcctcggccagtcaatgaagatcttc aagaacgagatcaagagcgacaccgttgacgagcctgcagacaagaccggcacgccggcg cacccggacgccgctgacggtacgacgcggaccgtcggcccgggcgaccagacgaagtcc taa

DBGET integrated database retrieval system