KEGG   Chromobacterium rhizoryzae: D1345_00335
Entry
D1345_00335       CDS       T05688                                 
Name
(GenBank) taurine dioxygenase
  KO
K03119  taurine dioxygenase [EC:1.14.11.17]
Organism
crz  Chromobacterium rhizoryzae
Pathway
crz00430  Taurine and hypotaurine metabolism
crz00920  Sulfur metabolism
Brite
KEGG Orthology (KO) [BR:crz00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    D1345_00335
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    D1345_00335
Enzymes [BR:crz01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.11  With 2-oxoglutarate as one donor, and incorporation of one atom of oxygen into each donor
    1.14.11.17  taurine dioxygenase
     D1345_00335
SSDB
Motif
Pfam: TauD
Other DBs
NCBI-ProteinID: AXT44747
UniProt: A0AAD0RLI1
LinkDB
Position
91138..91968
AA seq 276 aa
MSLQLQAISPALGAIVSGVDLSAPLSGAERDAIEAALLRHQVLFFENQPLTPRQQRDFAA
RFGDLHLHPVYPTVAEQPEIIVLDTHVDNLPDNDNWHTDVTFIATPPLGAVLSARQLPDV
GGDTLWSSNSAAYEALSPALRALLDGLSAEHSFVHSFPESRFKDTPQYARWQQASRDHPP
VVHPVVRTHPVTGRKGLFVNEGFTTRILELAPRESDALLALLFAHAARPEFTVRWRWKEN
DLAFWDNRVTQHYAVADYLPQRRVMHRATILGDRPR
NT seq 831 nt   +upstreamnt  +downstreamnt
atgagcctgcaactgcaagccatcagcccggccctgggggccatcgtttccggcgtcgac
ttgagcgcgccgctgtccggcgccgagcgcgatgcgatcgaggcggcgctgctgcgccat
caggtattgttcttcgagaaccagccgctgacgccgcgccagcagcgcgacttcgccgcc
cgcttcggcgatctgcacctgcatccggtctacccgacggtggcggagcagccggaaatc
atcgtgttggacacccatgtcgacaatctgccggacaacgacaactggcataccgacgtc
accttcatcgccaccccgccgctgggcgcggtgctgtcggcgcggcaactgccggatgtg
ggcggcgacacgctgtggagcagcaacagcgccgcttacgaagccttgtcgccggccttg
cgcgcgctgctggatggcctcagcgccgagcatagctttgtccattccttcccggaaagc
cgcttcaaggacacgccgcaatacgcgcgctggcaacaggccagccgcgaccatccgcca
gtggtgcacccggtggtgcgcacccatccggtcaccggccgcaagggcttgttcgtcaac
gagggcttcaccacccgcatcctggaactggcgccgcgcgagagcgatgccctgctggcc
ctgctgttcgcccatgccgcgcggccggaattcaccgtgcgctggcgctggaaggaaaac
gatctggcgttctgggacaaccgcgtcacccagcattacgcggtggcggattacctgccg
cagcggcgggtgatgcaccgtgccaccatattgggcgaccggccgcgttga

DBGET integrated database retrieval system