Chromobacterium rhizoryzae: D1345_01230 Help Entry D1345_01230       CDS       T05688                                  Symbol ftsL Name (GenBank) cell division protein FtsL   KO K03586   cell division protein FtsL Organism crz  Chromobacterium rhizoryzae Brite KEGG Orthology (KO) [BR:crz00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:crz03036]     D1345_01230 (ftsL) Chromosome and associated proteins [BR:crz03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     D1345_01230 (ftsL) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FtsL DivIC EMC3_TMCO1 Motif Other DBs NCBI-ProteinID:  AXT44906 UniProt:  A0AAD0W758 LinkDB All DBs Position 281648..281920 Genome browser AA seq 90 aa AA seqDB search MNKLNAILLVIVVLSAWSVVTSTHVSRKLYSDLQKERKSAQQLEIEFGQLQLEQSTWGAH AVIEKAASSRLDMHTPDPRQIQVVSPGKGM NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgaacaagctcaacgcgatactgctggtcatcgtggtgctgtccgcctggtcggtggtc acctcgacccatgtgtcgcgcaagctctacagcgatttgcagaaagaacgcaaatccgcc cagcagctggagatcgagttcggacagctgcagctggagcagagcacttggggcgcgcat gcggtgattgagaaagccgcgtccagccgcctcgacatgcataccccggatccgcgtcag atccaggtggtttcacctggaaaggggatgtga

DBGET integrated database retrieval system