KEGG   Chromobacterium rhizoryzae: D1345_23695
Entry
D1345_23695       CDS       T05688                                 
Symbol
yidC
Name
(GenBank) membrane protein insertase YidC
  KO
K03217  YidC/Oxa1 family membrane protein insertase
Organism
crz  Chromobacterium rhizoryzae
Pathway
crz02024  Quorum sensing
crz03060  Protein export
crz03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:crz00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    D1345_23695 (yidC)
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    D1345_23695 (yidC)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    D1345_23695 (yidC)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:crz03029]
    D1345_23695 (yidC)
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:crz02044]
    D1345_23695 (yidC)
Mitochondrial biogenesis [BR:crz03029]
 Mitochondrial quality control factors
  Mitochondrial respiratory chain complex assembly factors
   Complex-IV assembly factors
    D1345_23695 (yidC)
Secretion system [BR:crz02044]
 Sec (secretion) system
  Prokaryotic Sec-SRP core components
   D1345_23695 (yidC)
SSDB
Motif
Pfam: YidC_periplas 60KD_IMP SCIMP
Other DBs
NCBI-ProteinID: AXT48978
UniProt: A0AAD0RVT8
LinkDB
Position
complement(5166209..5167861)
AA seq 550 aa
MDSKRLIIFIVLSLGILLGWQEFFAPKPTPQQVAAQKQAATQQQAAGGASHNAQPVDSNK
LTSGQRITVNTDVLKAEIDTVGGDLRQLTLLKHDSAVDSKKPLELLTDRNGRVYVAQTGL
VAASNPALPTHKTVFTAEKTSYELSGDKLEVKLTAPEANGVKVSKIYTFTKGSYKIGVRY
DIANGGAAPLAATAYYRLLRDSQTPEGEGRLAHTFTGPAVYTSENKFQKVSFDDLAKGKG
DYAKTGSDGWVAMIQHYFMSAWILKPLDGASVCKDDKSCRFELKQSNGLNSAAALVDYAT
IAPGQSLSVSVPLFAGPEEYDVISKLADGMEYAKDFGIFHIFASPLFWLLTKLHLLVQNW
GWAIVLLTLTVKAIFYPLTAASYRSMAKMKALAPRLERMKEQYGDDRMKFQQAVMEMYKS
EKVNPLGGCLPMLIQIPVFIGLYWALLASVELRQAPWILWYTDLARPDPYYVLPVIMAAT
MFLQTFLNPPPADPMQAKMMKIMPVAFSVMFFFFPSGLVLYYVVNNILSMAQQWQINKSI
EKKNKAALQS
NT seq 1653 nt   +upstreamnt  +downstreamnt
atggactccaagcgactcataatcttcatcgtgctgtccctgggcatcctgctaggttgg
caggaattcttcgcgcccaagccgacgccgcagcaggtagccgcgcaaaagcaggccgcc
acgcagcaacaggccgccggcggcgcttcccacaacgcccagccggtggattccaacaaa
ctgacttccggccagcgcatcacggtgaacaccgatgtgctgaaggcggagatcgacacc
gttggcggcgatctgcgccagctgacgctgttgaagcacgattccgccgtggacagcaaa
aagccgcttgagctgctgacggaccggaacggccgcgtctatgtggcgcaaaccggcctg
gtggccgccagcaacccggcgctgcccacccacaaaaccgttttcaccgctgaaaaaacc
agctacgaactctccggcgacaagctggaagtgaagctgaccgcgccggaagccaatggc
gtgaaggtaagcaagatctacaccttcaccaagggcagctacaagattggcgtgcgttac
gacatcgccaacggcggcgccgcgccgctggccgccaccgcttactaccgcctgctgcgc
gacagccaaaccccggaaggcgaaggccgcctggcccacaccttcaccggcccggctgtt
tacacctcggaaaacaaattccagaaggtgagcttcgacgacctggccaagggcaagggc
gattacgccaagaccggcagcgacggctgggtggcgatgatccagcactacttcatgtcc
gcgtggatcctgaagccgctggacggcgccagcgtgtgcaaggacgacaagtcctgccgc
tttgagctgaaacagagcaacggcctgaactccgccgccgcgctggtggattacgccacc
atcgccccgggccagagcctgagcgtgtccgtgccgctgttcgccggcccggaagagtac
gatgtgatcagcaagctggccgacggcatggaatacgccaaggacttcggcatcttccac
atcttcgcctccccgctgttctggctgctgaccaagctgcacctgctggtgcagaactgg
ggctgggccatcgtgctgctgaccctgaccgtcaaggccatcttctacccgctgaccgcc
gcgtcctaccgctccatggccaagatgaaggcgctggcgccgcgtcttgagcgcatgaag
gagcagtacggcgacgaccgcatgaagttccagcaggcggtgatggagatgtacaagtcc
gagaaggtgaatccgctgggcggctgcctgcccatgctgatccagatcccggtgttcatc
ggcctgtactgggcgctgctggcttcggttgagctgcgccaggcgccgtggattctgtgg
tacaccgacttggcccgcccggacccgtactatgtgctgccggtaatcatggcggccacc
atgttcctgcaaaccttcctgaacccgccgccggcggacccgatgcaggccaagatgatg
aaaatcatgccggtggccttctcggtgatgttcttcttcttcccgtccggcctggtgctg
tactacgtggtcaacaacatcttgtcgatggcccagcagtggcagatcaacaagagcatc
gagaagaaaaacaaggccgcgctgcaatcctga

DBGET integrated database retrieval system