Chromohalobacter salexigens: Csal_2749 Help Entry Csal_2749         CDS       T00347                                  Name (GenBank) acyl carrier protein, putative   KO K02078   acyl carrier protein Organism csa  Chromohalobacter salexigens Pathway csa01100   Metabolic pathways csa01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:csa00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Csal_2749   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Csal_2749 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  ABE60096 UniProt:  Q1QTW2 LinkDB All DBs Position 3081039..3081302 Genome browser AA seq 87 aa AA seqDB search MTSELEQELKQLIIDTLELEDVTPEDIDPDEPLFVEGLGLDSIDALELGLALQKRYGIKL EADSDETRHHFRNLRTLAALVEERRSA NT seq 264 nt NT seq  +upstreamnt  +downstreamnt atgacgagtgagctggaacaagaactcaagcaattgatcatcgataccctcgaactcgag gacgtgaccccggaggatatcgatcccgacgaaccgctgttcgtcgaggggctcggcctg gattccatcgatgccctggaactggggctcgccctgcagaagcgctacggcatcaagctg gaagccgacagcgacgagacacgccatcacttccgcaacctgcgcaccctcgcggcgctg gtcgaggagcggcgcagcgcgtag

DBGET integrated database retrieval system