Castanea sativa (European chestnut): 142622233 Help Entry 142622233         CDS       T11266                                  Name (RefSeq) rac-like GTP-binding protein 5   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism csaa  Castanea sativa (European chestnut) Pathway csaa04145   Phagosome csaa04148   Efferocytosis csaa04620   Toll-like receptor signaling pathway csaa05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:csaa00001]  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     142622233    04148 Efferocytosis     142622233  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     142622233  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     142622233  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:csaa04131]     142622233   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:csaa04147]     142622233    04031 GTP-binding proteins [BR:csaa04031]     142622233 Membrane trafficking [BR:csaa04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     142622233  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     142622233   Macropinocytosis    Ras GTPases     142622233  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     142622233 Exosome [BR:csaa04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    142622233   Exosomal proteins of other body fluids (saliva and urine)    142622233   Exosomal proteins of colorectal cancer cells    142622233   Exosomal proteins of bladder cancer cells    142622233 GTP-binding proteins [BR:csaa04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     142622233 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU AAA_7 Motif Other DBs NCBI-GeneID:  142622233 NCBI-ProteinID:  XP_075651793 LinkDB All DBs Position 1:12137530..12144380 Genome browser AA seq 197 aa AA seqDB search MSASRFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWD TAGQEDYNRLRPLSYRGADVFILAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKL DLRDDKQFFIDHPGAVPITTAQGEELRKLIGSPAYIECSSKTQQNVKAVFDAAIKVVLQP PKQKKKKKKAQKGCSIL NT seq 594 nt NT seq  +upstreamnt  +downstreamnt atgagtgcgtccaggttcatcaagtgcgtcaccgtcggcgacggcgctgtcggcaaaact tgcatgttgatttcctacaccagcaatactttccctacggactatgtgccaacggttttt gacaacttcagtgctaatgtggttgtggatggaagcaccgttaaccttgggctatgggat actgctggtcaggaggattacaataggttaagacccttgagctatcgaggtgcagatgtg tttattcttgctttctctctcataagcaaggccagctatgaaaatgttgcaaaaaagtgg attcctgaattgaggcattacgcacctggagttccaataatcctcgttggaacaaagctc gatcttagggatgataagcagttctttatcgatcatccgggtgcagtgcccatcactaca gctcagggagaagagcttaggaaactgattggatctcctgcctacatcgagtgtagttca aaaacacagcagaacgttaaggcagtttttgatgcagccattaaggttgtgctacagcca ccaaagcaaaagaagaaaaagaaaaaggcacaaaagggttgttccatattgtga

DBGET integrated database retrieval system