Castanea sativa (European chestnut): 142622233 Help Entry 142622233         CDS       T11266                                  Name (RefSeq) rac-like GTP-binding protein 5   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism csaa  Castanea sativa (European chestnut) Pathway csaa04145   Phagosome csaa04148   Efferocytosis csaa04517   IgSF CAM signaling csaa04518   Integrin signaling csaa04620   Toll-like receptor signaling pathway csaa05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:csaa00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     142622233    04518 Integrin signaling     142622233  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     142622233    04148 Efferocytosis     142622233  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     142622233  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     142622233  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:csaa04131]     142622233   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:csaa04147]     142622233    04031 GTP-binding proteins [BR:csaa04031]     142622233 Membrane trafficking [BR:csaa04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     142622233  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     142622233   Macropinocytosis    Ras GTPases     142622233  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     142622233 Exosome [BR:csaa04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    142622233   Exosomal proteins of other body fluids (saliva and urine)    142622233   Exosomal proteins of colorectal cancer cells    142622233   Exosomal proteins of bladder cancer cells    142622233 GTP-binding proteins [BR:csaa04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     142622233 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU AAA_7 Motif Other DBs NCBI-GeneID:  142622233 NCBI-ProteinID:  XP_075651793 LinkDB All DBs Position 1:12137530..12144380 Genome browser AA seq 197 aa AA seqDB search MSASRFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWD TAGQEDYNRLRPLSYRGADVFILAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKL DLRDDKQFFIDHPGAVPITTAQGEELRKLIGSPAYIECSSKTQQNVKAVFDAAIKVVLQP PKQKKKKKKAQKGCSIL NT seq 594 nt NT seq  +upstreamnt  +downstreamnt atgagtgcgtccaggttcatcaagtgcgtcaccgtcggcgacggcgctgtcggcaaaact tgcatgttgatttcctacaccagcaatactttccctacggactatgtgccaacggttttt gacaacttcagtgctaatgtggttgtggatggaagcaccgttaaccttgggctatgggat actgctggtcaggaggattacaataggttaagacccttgagctatcgaggtgcagatgtg tttattcttgctttctctctcataagcaaggccagctatgaaaatgttgcaaaaaagtgg attcctgaattgaggcattacgcacctggagttccaataatcctcgttggaacaaagctc gatcttagggatgataagcagttctttatcgatcatccgggtgcagtgcccatcactaca gctcagggagaagagcttaggaaactgattggatctcctgcctacatcgagtgtagttca aaaacacagcagaacgttaaggcagtttttgatgcagccattaaggttgtgctacagcca ccaaagcaaaagaagaaaaagaaaaaggcacaaaagggttgttccatattgtga

DBGET integrated database retrieval system