Castanea sativa (European chestnut): 142629973 Help Entry 142629973         CDS       T11266                                  Name (RefSeq) ADP-ribosylation factor 2-like   KO K07937   ADP-ribosylation factor 1/2 Organism csaa  Castanea sativa (European chestnut) Pathway csaa04144   Endocytosis Brite KEGG Orthology (KO) [BR:csaa00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     142629973  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:csaa04131]     142629973   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:csaa04147]     142629973    04031 GTP-binding proteins [BR:csaa04031]     142629973 Membrane trafficking [BR:csaa04131]  Endocytosis   Lipid raft mediated endocytosis    GRAF1-dependent endocytosis     142629973   Arf GTPases and associated proteins    Arf GTPases     142629973  Endosome - Golgi transport     142629973 Exosome [BR:csaa04147]  Exosomal proteins   Proteins found in most exosomes    142629973 GTP-binding proteins [BR:csaa04031]  Small (monomeric) G-proteins   Arf/Sar Family    Arf [OT]     142629973 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Arf SRPRB Gtr1_RagA G-alpha EcoRI FLAD1_M Motif Other DBs NCBI-GeneID:  142629973 NCBI-ProteinID:  XP_075660147 LinkDB All DBs Position 3:2773790..2774956 Genome browser AA seq 113 aa AA seqDB search MVHVQIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELREAVLLVFANKQ DLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA NT seq 342 nt NT seq  +upstreamnt  +downstreamnt atggtgcatgtacagattcgacctttgtggagacattacttccaaaacactcaagggctt atcttcgtggttgatagcaatgaccgtgaccgtgtggttgaggctagggatgagctgcat cggatgttgaatgaggatgaattgagggaggctgtgctgcttgtatttgcaaacaagcag gatcttccaaatgccatgaatgccgctgaaataactgataagcttggtcttcattccctc cgtcaacgccactggtatatccagagcacatgtgccacttcaggggaagggctgtacgag ggactagactggctttccaacaatattgctaacaaggcttag

DBGET integrated database retrieval system