KEGG   Castanea sativa (European chestnut): 142636430
Entry
142636430         CDS       T11266                                 
Name
(RefSeq) SKP1-like protein 1A
  KO
K03094  S-phase kinase-associated protein 1
Organism
csaa  Castanea sativa (European chestnut)
Pathway
csaa03083  Polycomb repressive complex
csaa04120  Ubiquitin mediated proteolysis
csaa04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:csaa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    142636430
   04120 Ubiquitin mediated proteolysis
    142636430
  09126 Chromosome
   03083 Polycomb repressive complex
    142636430
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:csaa04131]
    142636430
   04121 Ubiquitin system [BR:csaa04121]
    142636430
   03036 Chromosome and associated proteins [BR:csaa03036]
    142636430
Membrane trafficking [BR:csaa04131]
 Endosome - Lysosome transport
  Acidification regulators
   RAVE complex
    142636430
Ubiquitin system [BR:csaa04121]
 Ubiquitin ligases (E3)
  Multi subunit type E3
   SCF complex
    Adaptor protein
     142636430
   Cul7 complex
     142636430
Chromosome and associated proteins [BR:csaa03036]
 Eukaryotic type
  Histone modification proteins
   Polycomb repressive complex (PRC) and associated proteins
    Noncanonical PRC1 (PRC1.1)
     142636430
  Centromeric chromatin formation proteins
   Kinetochore proteins
    CBF3 complex
     142636430
SSDB
Motif
Pfam: Skp1 Skp1_POZ
Other DBs
NCBI-GeneID: 142636430
NCBI-ProteinID: XP_075666783
LinkDB
Position
5:59032274..59032895
AA seq 184 aa
MSNTSENPNPSSSSAKITLKPSDNELFEVEEAVAMKFCTVKQYFEDKKDNDVAARGSTTV
IPLPNVHSAVLATLISYGKKLPQSNAVADNHEEEETKKKERKQYEQELIKNLKPGELVDL
ISAANYLDFKEGLEFFNQALADHIQNKSVEYVRKFFGIKGDYEPHEEEKYREEYAWAFEG
VDED
NT seq 555 nt   +upstreamnt  +downstreamnt
atgtctaacactagcgaaaacccgaaccctagttcatcttcagccaaaattaccctaaaa
ccctcagacaacgaactattcgaggttgaagaagccgtggccatgaaattctgcaccgtc
aagcaatactttgaagacaagaaagacaacgatgtggccgcgcgtggctccaccactgtc
atccctctcccgaacgttcacagtgccgtcctcgccactctcatctcctacggcaagaaa
cttccccagagcaatgccgttgcggacaaccatgaggaggaagagacgaagaagaaagag
aggaagcaatatgagcaagagttgataaagaacctgaagcctggggaactcgtggaccta
atatctgctgctaactatttggacttcaaggaagggctggagttcttcaaccaggccttg
gctgatcacatccagaacaagagcgtcgagtatgttcggaagttctttggtatcaagggc
gattacgagccccacgaggaggagaagtatcgcgaagagtatgcttgggctttcgaggga
gtcgatgaggattag

DBGET integrated database retrieval system