Chlorocebus sabaeus (green monkey): 103215297 Help Entry 103215297         CDS       T04361                                  Symbol DEFB1 Name (RefSeq) defensin beta 1   KO K23125   beta-defensin 1 Organism csab  Chlorocebus sabaeus (green monkey) Pathway csab02010   ABC transporters csab05150   Staphylococcus aureus infection Brite KEGG Orthology (KO) [BR:csab00001]  09130 Environmental Information Processing   09131 Membrane transport    02010 ABC transporters     103215297 (DEFB1)  09160 Human Diseases   09171 Infectious disease: bacterial    05150 Staphylococcus aureus infection     103215297 (DEFB1)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:csab02000]     103215297 (DEFB1)    03037 Cilium and associated proteins [BR:csab03037]     103215297 (DEFB1) Transporters [BR:csab02000]  Other transporters   Pores ion channels [TC:1]    103215297 (DEFB1) Cilium and associated proteins [BR:csab03037]  Motile cilia and associated proteins   Sperm associated proteins    103215297 (DEFB1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Defensin_beta Motif Other DBs NCBI-GeneID:  103215297 NCBI-ProteinID:  XP_007959804 Ensembl:  ENSCSAG00000016993 UniProt:  A0A0D9RWQ1 LinkDB All DBs Position 8:complement(6643753..6652209) Genome browser AA seq 68 aa AA seqDB search MRTSYLLLFTLCLLLSEMASGDNFLTGLGHRSDHYNCVRSGGQCLYSACPIYTKIQGTCY HGKAKCCK NT seq 207 nt NT seq  +upstreamnt  +downstreamnt atgagaacttcctaccttttgctgtttactctctgcttactcttgtctgagatggcctca ggcgataactttctcacaggtcttggccacagatctgaccattacaactgcgtcaggagt ggagggcaatgtctctattctgcctgcccaatctataccaaaattcaaggcacctgttac cacgggaaagccaagtgctgcaagtga

DBGET integrated database retrieval system