Chlorocebus sabaeus (green monkey): 103216224 Help Entry 103216224         CDS       T04361                                  Symbol FAS Name (RefSeq) Fas cell surface death receptor   KO K04390   tumor necrosis factor receptor superfamily member 6 Organism csab  Chlorocebus sabaeus (green monkey) Pathway csab01524   Platinum drug resistance csab04010   MAPK signaling pathway csab04060   Cytokine-cytokine receptor interaction csab04115   p53 signaling pathway csab04210   Apoptosis csab04217   Necroptosis csab04650   Natural killer cell mediated cytotoxicity csab04668   TNF signaling pathway csab04932   Non-alcoholic fatty liver disease csab04936   Alcoholic liver disease csab04940   Type I diabetes mellitus csab05010   Alzheimer disease csab05022   Pathways of neurodegeneration - multiple diseases csab05142   Chagas disease csab05143   African trypanosomiasis csab05160   Hepatitis C csab05161   Hepatitis B csab05162   Measles csab05163   Human cytomegalovirus infection csab05164   Influenza A csab05165   Human papillomavirus infection csab05167   Kaposi sarcoma-associated herpesvirus infection csab05168   Herpes simplex virus 1 infection csab05169   Epstein-Barr virus infection csab05170   Human immunodeficiency virus 1 infection csab05200   Pathways in cancer csab05205   Proteoglycans in cancer csab05320   Autoimmune thyroid disease csab05330   Allograft rejection csab05332   Graft-versus-host disease csab05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:csab00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     103216224 (FAS)    04668 TNF signaling pathway     103216224 (FAS)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     103216224 (FAS)  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     103216224 (FAS)    04217 Necroptosis     103216224 (FAS)    04115 p53 signaling pathway     103216224 (FAS)  09150 Organismal Systems   09151 Immune system    04650 Natural killer cell mediated cytotoxicity     103216224 (FAS)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     103216224 (FAS)    05205 Proteoglycans in cancer     103216224 (FAS)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     103216224 (FAS)    05161 Hepatitis B     103216224 (FAS)    05160 Hepatitis C     103216224 (FAS)    05164 Influenza A     103216224 (FAS)    05162 Measles     103216224 (FAS)    05168 Herpes simplex virus 1 infection     103216224 (FAS)    05163 Human cytomegalovirus infection     103216224 (FAS)    05167 Kaposi sarcoma-associated herpesvirus infection     103216224 (FAS)    05169 Epstein-Barr virus infection     103216224 (FAS)    05165 Human papillomavirus infection     103216224 (FAS)   09174 Infectious disease: parasitic    05142 Chagas disease     103216224 (FAS)    05143 African trypanosomiasis     103216224 (FAS)   09163 Immune disease    05320 Autoimmune thyroid disease     103216224 (FAS)    05330 Allograft rejection     103216224 (FAS)    05332 Graft-versus-host disease     103216224 (FAS)   09164 Neurodegenerative disease    05010 Alzheimer disease     103216224 (FAS)    05022 Pathways of neurodegeneration - multiple diseases     103216224 (FAS)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     103216224 (FAS)   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     103216224 (FAS)    04936 Alcoholic liver disease     103216224 (FAS)    04932 Non-alcoholic fatty liver disease     103216224 (FAS)   09176 Drug resistance: antineoplastic    01524 Platinum drug resistance     103216224 (FAS)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04050 Cytokine receptors [BR:csab04050]     103216224 (FAS)    04090 CD molecules [BR:csab04090]     103216224 (FAS) Cytokine receptors [BR:csab04050]  Tumor necrosis factor receptors   TNF receptor superfamily    103216224 (FAS) CD molecules [BR:csab04090]  Proteins   103216224 (FAS) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Death TNFR_c6 Peptidase_C8 Motif Other DBs NCBI-GeneID:  103216224 NCBI-ProteinID:  XP_007961682 LinkDB All DBs Position 9:82418653..82444125 Genome browser AA seq 351 aa AA seqDB search MSFWRLVYLFLLSYRKRNCRLPSGNSLLNTVLTSVARLLSKCVNAQVTDISSKEFELRKI VTTIETQNLEGLHHEGQFCRDPCPPGERKARDCTVNEDEPDCVPCQEGKEYTDKGHFSSK CRRCRLCDEGHGLEVEINCTRTQNTKCRCKPNFFCNSAVCEHCDPCTKCKHGIIEECTLT SNTKCKEEDSRSDLPWLCLLLLLIPPIVYVVIKKTCRKHRKENQGPHESTTLNPETAINL SDVDLSKYITTIAGLMTLSQVRDFVRKNGVSEAKIDEIKNDNVQDTAEQKVQLLRNWYQL HGKKDACDTLIKGLKTADLCTVAEKVHAVILKDITSDTENSNFGNEVQNLV NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt atgagcttctggaggcttgtttacctttttttattgtcatacagaaaaagaaactgtcgt ctcccttccgggaattctctgcttaacactgttcttacctctgttgctagattattgtcc aaatgtgttaatgcccaagtgactgatatcagctccaaggaatttgaattgaggaagatc gttactacaattgagactcagaacttggaaggcctgcatcacgagggccaattctgccgt gacccctgtcctccaggtgaaaggaaagctagggactgcacagtcaatgaggatgaacca gactgcgtgccctgccaagaagggaaggagtacacagacaaaggccatttttcttccaaa tgcagaagatgtagattgtgtgatgaaggacatggcttagaagtggaaataaactgcacc cggacccagaataccaagtgcagatgtaaaccaaactttttttgtaactctgctgtatgt gaacactgtgacccttgcaccaagtgtaaacatggaatcatcgaggaatgcacactcacc agcaacaccaagtgcaaagaggaagattccagatctgatttgccgtggttatgtcttctt cttctcctaattccaccaattgtttatgtggtgataaagaaaacatgcagaaagcacaga aaggaaaaccaaggtcctcatgaatctacaaccttaaatcctgaaacagcaataaattta tctgatgttgacttaagtaaatatatcaccactatcgctggactcatgacactaagtcaa gttagagactttgttcgaaagaatggtgtcagtgaagccaaaatagatgagatcaagaat gacaatgtccaagacacagcagaacaaaaagttcaactgcttcgtaattggtatcaactt catggaaagaaagatgcatgtgacacattgattaaaggtctaaaaacagccgatctttgt actgttgcagagaaagttcacgctgtcatcctcaaggacattactagtgacacagaaaat tcgaacttcggaaatgaagtccaaaacttggtctag

DBGET integrated database retrieval system