KEGG   Chlorocebus sabaeus (green monkey): 103217114
Entry
103217114         CDS       T04361                                 
Symbol
MRAP
Name
(RefSeq) melanocortin 2 receptor accessory protein
  KO
K22398  melanocortin 2 receptor accessory protein
Organism
csab  Chlorocebus sabaeus (green monkey)
Pathway
csab04927  Cortisol synthesis and secretion
csab04934  Cushing syndrome
Brite
KEGG Orthology (KO) [BR:csab00001]
 09150 Organismal Systems
  09152 Endocrine system
   04927 Cortisol synthesis and secretion
    103217114 (MRAP)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103217114 (MRAP)
SSDB
Motif
Pfam: MRAP FixQ
Other DBs
NCBI-GeneID: 103217114
NCBI-ProteinID: XP_007963186
Ensembl: ENSCSAG00000009456
UniProt: A0A0D9RAS4
LinkDB
Position
2:complement(59815547..59834674)
AA seq 172 aa
MANGTNASAPYYSYEYYLDYLDLIPVDEKKLKAHKHSIVIAFWVSLAAFVLLLFLILLYM
SWSGSPQMKNSPKHHQACPWSHSLSLQLCIQKCLPCHREPLGTSQAQARSVEPGSRTDPD
QLLRQESSSTLPLGIFQTHPTLLWELTLNGGPLVRSKPSEPPPGDRTSQLQS
NT seq 519 nt   +upstreamnt  +downstreamnt
atggccaacgggaccaacgcctctgccccatactacagctatgaatactacctggactat
ctggacctcattcccgtagacgagaagaagctgaaagcccacaaacattccatcgtgatc
gccttctgggtgagcctggctgccttcgtgctgctcctcttcctcatcctgctttacatg
tcctggtcgggctccccgcagatgaagaacagccccaagcaccaccaagcatgcccctgg
agtcacagcctcagcctccagctctgcatccagaagtgcctgccgtgccacagggaaccc
ctggggacctcacaggctcaggcgcgttcagtggagccagggagcagaactgaccctgac
cagctgctacgacaggagagctcctccaccttgccccttgggattttccagacccacccc
actctcctctgggaactgaccctcaatgggggtcccctcgtcaggagcaagcccagcgag
cctccccctggagacaggacctctcaattgcagagctga

DBGET integrated database retrieval system