Chlorocebus sabaeus (green monkey): 103218000 Help Entry 103218000         CDS       T04361                                  Symbol CCL20 Name (RefSeq) C-C motif chemokine ligand 20   KO K14625   C-C motif chemokine 20 Organism csab  Chlorocebus sabaeus (green monkey) Pathway csab04060   Cytokine-cytokine receptor interaction csab04061   Viral protein interaction with cytokine and cytokine receptor csab04062   Chemokine signaling pathway csab04657   IL-17 signaling pathway csab04668   TNF signaling pathway csab05323   Rheumatoid arthritis Brite KEGG Orthology (KO) [BR:csab00001]  09130 Environmental Information Processing   09132 Signal transduction    04668 TNF signaling pathway     103218000 (CCL20)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     103218000 (CCL20)    04061 Viral protein interaction with cytokine and cytokine receptor     103218000 (CCL20)  09150 Organismal Systems   09151 Immune system    04657 IL-17 signaling pathway     103218000 (CCL20)    04062 Chemokine signaling pathway     103218000 (CCL20)  09160 Human Diseases   09163 Immune disease    05323 Rheumatoid arthritis     103218000 (CCL20)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:csab04052]     103218000 (CCL20) Cytokines and neuropeptides [BR:csab04052]  Cytokines   Chemokines    103218000 (CCL20) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  103218000 NCBI-ProteinID:  XP_007964703 Ensembl:  ENSCSAG00000007082 LinkDB All DBs Position 10:113815099..113836562 Genome browser AA seq 162 aa AA seqDB search MCYSKSLLLAALMSVLLLHLCSESEAASNFDCCLRYTDRILHPKFIVGFTQQLANETCDI NAVIFHTKKGLSVCANPKQTWVKLIVRRLRYVTLTFSLCKGLRKEEYSKGRAVGFLRFFS LTTVEFLKGKFELDHKNKECIFPLVDHHGYYYFNLLISYMMY NT seq 489 nt NT seq  +upstreamnt  +downstreamnt atgtgctatagcaagagtttgctcctggccgctttgatgtcagtgctgctactccacctt tgcagcgaatcagaagcagcaagcaactttgactgctgtcttcgatatacagaccgtatc cttcatcctaaatttattgtgggcttcacacagcagctggccaatgaaacctgtgacatc aatgctgtcatctttcacacaaagaaagggttgtctgtgtgcgcaaatccaaagcagacc tgggtgaaattgattgtacgtcgcctcaggtatgttacactgacatttagcctctgcaaa ggtttgaggaaagaggagtattcaaaggggcgggccgtaggttttctgagattctttagt ctaactactgtggaatttttaaagggaaaatttgagttggaccacaaaaacaaagaatgc atttttccacttgtagatcatcatggttattattattttaatttactgatttcttatatg atgtattag

DBGET integrated database retrieval system