Chlorocebus sabaeus (green monkey): 103218996 Help Entry 103218996         CDS       T04361                                  Symbol CDC26 Name (RefSeq) cell division cycle 26   KO K03359   anaphase-promoting complex subunit 12 Organism csab  Chlorocebus sabaeus (green monkey) Pathway csab04110   Cell cycle csab04114   Oocyte meiosis csab04120   Ubiquitin mediated proteolysis csab04914   Progesterone-mediated oocyte maturation csab05166   Human T-cell leukemia virus 1 infection Brite KEGG Orthology (KO) [BR:csab00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     103218996 (CDC26)  09140 Cellular Processes   09143 Cell growth and death    04110 Cell cycle     103218996 (CDC26)    04114 Oocyte meiosis     103218996 (CDC26)  09150 Organismal Systems   09152 Endocrine system    04914 Progesterone-mediated oocyte maturation     103218996 (CDC26)  09160 Human Diseases   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     103218996 (CDC26)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:csab04121]     103218996 (CDC26)    03036 Chromosome and associated proteins [BR:csab03036]     103218996 (CDC26) Ubiquitin system [BR:csab04121]  Ubiquitin ligases (E3)   Multi subunit Ring-finger type E3    APC/C     Other subunits      103218996 (CDC26) Chromosome and associated proteins [BR:csab03036]  Eukaryotic type   Sister chromatid separation proteins    APC/C complex     103218996 (CDC26) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ANAPC_CDC26 Motif Other DBs NCBI-GeneID:  103218996 NCBI-ProteinID:  XP_007966561 Ensembl:  ENSCSAG00000012412 LinkDB All DBs Position 12:26296836..26305094 Genome browser AA seq 109 aa AA seqDB search MNDVHTYRICLDAEDNPVNCVDFSMLRRKPTRLELKLDDIEEFESIRKDLETRKKQKEDV EVVGGSDGEGAIGLSSDPKSREQMINDRIGYKPQPKPNNRSSQFGSLEF NT seq 330 nt NT seq  +upstreamnt  +downstreamnt atgaatgacgtacacacatataggatctgtttggacgctgaggataatcctgtgaattgt gttgacttcagtatgctgagacgaaaaccaacacgcctagagctaaagcttgatgacatt gaagagtttgagagcattcgaaaggacctggagacccgtaagaaacagaaggaagatgtg gaagttgtaggaggcagtgatggagaaggagccattgggctcagcagtgaccccaagagc cgggaacaaatgatcaatgatcggattggttataaaccccaacccaagcccaataatcgt tcatctcaatttggaagtcttgaattttag

DBGET integrated database retrieval system