Chlorocebus sabaeus (green monkey): 103219254 Help Entry 103219254         CDS       T04361                                  Symbol CCL27 Name (RefSeq) C-C motif chemokine ligand 27   KO K16598   C-C motif chemokine 27 Organism csab  Chlorocebus sabaeus (green monkey) Pathway csab04060   Cytokine-cytokine receptor interaction csab04061   Viral protein interaction with cytokine and cytokine receptor csab04062   Chemokine signaling pathway Brite KEGG Orthology (KO) [BR:csab00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     103219254 (CCL27)    04061 Viral protein interaction with cytokine and cytokine receptor     103219254 (CCL27)  09150 Organismal Systems   09151 Immune system    04062 Chemokine signaling pathway     103219254 (CCL27)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:csab04052]     103219254 (CCL27) Cytokines and neuropeptides [BR:csab04052]  Cytokines   Chemokines    103219254 (CCL27) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  103219254 NCBI-ProteinID:  XP_007967098 Ensembl:  ENSCSAG00000010180 UniProt:  A0A0D9RCS2 LinkDB All DBs Position 12:45956596..45959354 Genome browser AA seq 112 aa AA seqDB search MKGPSTFCSLLLLSLLLSPDPTAAFLLPPSTACCTQLYRKPLSDKLLRKVIRVELQEADG DCHLQAFVLHLAQRSICIHPQNPSLSQWFEHQERKLHGTLPNLNFGMLRKMG NT seq 339 nt NT seq  +upstreamnt  +downstreamnt atgaaggggccctcaaccttctgcagtctcctgctcctgtcattgctcctgagcccagac cctacagcagcattcctactgccacccagcactgcctgctgtactcagctctaccgaaag ccactctcagacaagctactgaggaaggtcatccgggtggaactgcaggaggctgatggg gactgtcatctccaggctttcgtgcttcacctggctcaacgcagcatctgcatccacccc cagaaccccagcctgtcacagtggtttgagcaccaagagagaaagctccacgggactctg cccaacctgaattttgggatgctaaggaaaatgggctga

DBGET integrated database retrieval system