Chlorocebus sabaeus (green monkey): 103219378 Help Entry 103219378         CDS       T04361                                  Name (RefSeq) interferon alpha-4-like   KO K05414   interferon alpha Organism csab  Chlorocebus sabaeus (green monkey) Pathway csab04060   Cytokine-cytokine receptor interaction csab04151   PI3K-Akt signaling pathway csab04217   Necroptosis csab04620   Toll-like receptor signaling pathway csab04621   NOD-like receptor signaling pathway csab04622   RIG-I-like receptor signaling pathway csab04623   Cytosolic DNA-sensing pathway csab04630   JAK-STAT signaling pathway csab04650   Natural killer cell mediated cytotoxicity csab04936   Alcoholic liver disease csab05152   Tuberculosis csab05160   Hepatitis C csab05161   Hepatitis B csab05162   Measles csab05163   Human cytomegalovirus infection csab05164   Influenza A csab05165   Human papillomavirus infection csab05167   Kaposi sarcoma-associated herpesvirus infection csab05168   Herpes simplex virus 1 infection csab05169   Epstein-Barr virus infection csab05170   Human immunodeficiency virus 1 infection csab05171   Coronavirus disease - COVID-19 csab05200   Pathways in cancer csab05320   Autoimmune thyroid disease csab05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:csab00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     103219378    04151 PI3K-Akt signaling pathway     103219378   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     103219378  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     103219378  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     103219378    04621 NOD-like receptor signaling pathway     103219378    04622 RIG-I-like receptor signaling pathway     103219378    04623 Cytosolic DNA-sensing pathway     103219378    04650 Natural killer cell mediated cytotoxicity     103219378  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     103219378   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     103219378    05161 Hepatitis B     103219378    05160 Hepatitis C     103219378    05171 Coronavirus disease - COVID-19     103219378    05164 Influenza A     103219378    05162 Measles     103219378    05168 Herpes simplex virus 1 infection     103219378    05163 Human cytomegalovirus infection     103219378    05167 Kaposi sarcoma-associated herpesvirus infection     103219378    05169 Epstein-Barr virus infection     103219378    05165 Human papillomavirus infection     103219378   09171 Infectious disease: bacterial    05152 Tuberculosis     103219378   09163 Immune disease    05320 Autoimmune thyroid disease     103219378   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     103219378   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     103219378  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:csab04052]     103219378 Cytokines and neuropeptides [BR:csab04052]  Cytokines   Interferons    103219378 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Interferon Cnd1 iSTAND Mkg_C Motif Other DBs NCBI-GeneID:  103219378 NCBI-ProteinID:  XP_007967301 Ensembl:  ENSCSAG00000000436 UniProt:  A0A0D9S9M8 LinkDB All DBs Position 12:58571435..58572631 Genome browser AA seq 189 aa AA seqDB search MALSFSLLMAVVVLSYKSICSLGCDLPQTHSLGHRRALILLAQMGRISLSSCLKDRHDFA FPQEEFDGNQFQKAQAISVLHEMIQQTFNLFSTKDSSAAWEQNLLEKFSTELYQQLSDLE ACVRQEAGVGETLLMNEDSVLAVRKYFQRITLYLTEKKYSPCAWEVVRAEIMRSLSFSTN LQRRLRRKD NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atggccctgtccttttctttactgatggccgtggtggtgctcagctacaaatccatctgc tctctgggctgtgatctgcctcagacccacagcctgggtcataggagggccttgatactc ctggcacaaatgggaagaatctctctttcctcctgcctgaaggacaggcatgactttgca ttcccccaggaggagtttgatggcaaccagttccagaaggctcaagccatctctgtcctc catgagatgatccagcagaccttcaacctcttcagcacaaaggactcatctgctgcttgg gaacagaacctcctagaaaaattttccactgaactttaccagcaactgagtgacttggaa gcctgtgtaagacaggaggccggggtgggagagactctgctgatgaatgaggactccgtc ctggctgtgaggaaatacttccaaagaatcactctctatctgacagagaagaaatacagc ccttgtgcctgggaggttgtcagagcagaaatcatgagatccctctctttttcaacaaac ttgcaaagaagattaaggaggaaggattga

DBGET integrated database retrieval system