Chlorocebus sabaeus (green monkey): 103219629 Help Entry 103219629         CDS       T04361                                  Symbol CSTB Name (RefSeq) cystatin B   KO K13907   cystatin-A/B Organism csab  Chlorocebus sabaeus (green monkey) Brite KEGG Orthology (KO) [BR:csab00001]  09180 Brite Hierarchies   09181 Protein families: metabolism    01002 Peptidases and inhibitors [BR:csab01002]     103219629 (CSTB)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:csab04147]     103219629 (CSTB) Peptidases and inhibitors [BR:csab01002]  Peptidase inhibitors   Family I25: cystatin family    103219629 (CSTB) Exosome [BR:csab04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    103219629 (CSTB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Cystatin Dynein_light SQAPI Motif Other DBs NCBI-GeneID:  103219629 NCBI-ProteinID:  XP_007967753 Ensembl:  ENSCSAG00000007941 UniProt:  A0A0D9R6G9 LinkDB All DBs Position 2:complement(87551341..87555145) Genome browser AA seq 98 aa AA seqDB search MMCGAPSTVQPATAETQDIADQVRSQLEEKENKKFPVFKAVSFKSQVVAGTNYFIKVHVG DEDFVHLRVFKSLPHENKPLTLSNYQTNKAKHDELSYF NT seq 297 nt NT seq  +upstreamnt  +downstreamnt atgatgtgcggggcgccctccaccgtgcagccggccaccgccgagacccaggacatcgcc gaccaggtgaggtcccagcttgaagagaaagaaaacaagaagttccctgtatttaaggcc gtgtcgttcaagagccaggtggtcgcggggacaaactacttcatcaaggtgcacgttggc gacgaggacttcgtacacctgcgagtgttcaaatctctccctcacgaaaacaagcccttg accttgtctaactaccagaccaacaaagccaagcacgacgagctgagctatttctga

DBGET integrated database retrieval system