Chlorocebus sabaeus (green monkey): 103221232 Help Entry 103221232         CDS       T04361                                  Name (RefSeq) thioredoxin   KO K03671   thioredoxin Organism csab  Chlorocebus sabaeus (green monkey) Pathway csab04621   NOD-like receptor signaling pathway csab05012   Parkinson disease csab05132   Salmonella infection csab05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:csab00001]  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     103221232  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     103221232   09164 Neurodegenerative disease    05012 Parkinson disease     103221232   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     103221232  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:csab03110]     103221232 Chaperones and folding catalysts [BR:csab03110]  Protein folding catalysts   Protein disulfide isomerase    103221232 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Thioredoxin Thioredoxin_8 DIM1 Thioredoxin_2 OST3_OST6 AhpC-TSA Thioredoxin_9 Thioredoxin_7 Glutaredoxin Redoxin Motif Other DBs NCBI-GeneID:  103221232 NCBI-ProteinID:  XP_007970262 Ensembl:  ENSCSAG00000018885 UniProt:  A0A0D9SC15 LinkDB All DBs Position 15:complement(15113620..15114076) Genome browser AA seq 105 aa AA seqDB search MVKQIESKAAFQEALNTAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVVFLEVDVD DCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV NT seq 318 nt NT seq  +upstreamnt  +downstreamnt atggtgaagcagatcgagagcaaggctgcttttcaggaagccttgaacaccgcaggtgat aaacttgtagtagttgacttctcagccacgtggtgtgggccttgcaaaatgatcaagcct ttctttcattccctctctgaaaagtattccaacgtggtattccttgaagtagatgtggat gactgtcaggatgttgcttcagagtgtgaagtcaaatgcatgccaacattccagtttttt aagaagggacaaaaggtgggtgaattttctggagccaataaggaaaagcttgaagccacc attaatgaattagtctaa

DBGET integrated database retrieval system