Chlorocebus sabaeus (green monkey): 103221761 Help Entry 103221761         CDS       T04361                                  Symbol CSNK2B Name (RefSeq) casein kinase 2 beta   KO K03115   casein kinase II subunit beta Organism csab  Chlorocebus sabaeus (green monkey) Pathway csab03008   Ribosome biogenesis in eukaryotes csab03083   Polycomb repressive complex csab04064   NF-kappa B signaling pathway csab04137   Mitophagy - animal csab04310   Wnt signaling pathway csab04520   Adherens junction csab05010   Alzheimer disease csab05020   Prion disease csab05022   Pathways of neurodegeneration - multiple diseases csab05162   Measles csab05235   PD-L1 expression and PD-1 checkpoint pathway in cancer Brite KEGG Orthology (KO) [BR:csab00001]  09120 Genetic Information Processing   09122 Translation    03008 Ribosome biogenesis in eukaryotes     103221761 (CSNK2B)   09126 Chromosome    03083 Polycomb repressive complex     103221761 (CSNK2B)  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     103221761 (CSNK2B)    04064 NF-kappa B signaling pathway     103221761 (CSNK2B)  09140 Cellular Processes   09141 Transport and catabolism    04137 Mitophagy - animal     103221761 (CSNK2B)   09144 Cellular community - eukaryotes    04520 Adherens junction     103221761 (CSNK2B)  09160 Human Diseases   09161 Cancer: overview    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     103221761 (CSNK2B)   09172 Infectious disease: viral    05162 Measles     103221761 (CSNK2B)   09164 Neurodegenerative disease    05010 Alzheimer disease     103221761 (CSNK2B)    05020 Prion disease     103221761 (CSNK2B)    05022 Pathways of neurodegeneration - multiple diseases     103221761 (CSNK2B)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03009 Ribosome biogenesis [BR:csab03009]     103221761 (CSNK2B)    03036 Chromosome and associated proteins [BR:csab03036]     103221761 (CSNK2B) Ribosome biogenesis [BR:csab03009]  Eukaryotic type   90S particles    Kinase     103221761 (CSNK2B) Chromosome and associated proteins [BR:csab03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.3/1.5)      103221761 (CSNK2B) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CK_II_beta Motif Other DBs NCBI-GeneID:  103221761 NCBI-ProteinID:  XP_007971318 Ensembl:  ENSCSAG00000008597 LinkDB All DBs Position 17:complement(40354520..40359136) Genome browser AA seq 234 aa AA seqDB search MEKCKGTSRMAGTTSADVKMSSSEEVSWISWFCGLRGNEFFCEVDEDYIQDKFNLTGLNE QVPHYRQALDMILDLEPDEELEDNPNQSDLIEQAAEMLYGLIHARYILTNRGIAQMLEKY QQGDFGYCPRVYCENQPMLPIGLSDIPGEAMVKLYCPKCMDVYTPKSSRHHHTDGAYFGT GFPHMLFMVHPEYRPKRPANQFVPRLYGFKIHPMAYQLQLQAASNFKSPVKTIR NT seq 705 nt NT seq  +upstreamnt  +downstreamnt atggagaagtgcaagggcacgagcagaatggctggcaccacctcagctgacgtgaagatg agcagctcagaggaggtgtcctggatttcctggttctgtgggctccgtggcaatgaattc ttctgtgaagtggatgaagactacatccaggacaaatttaatcttactggactcaatgag caggtgcctcactatcgacaagctctagacatgatcttggacctggagcctgatgaagaa ctggaagacaaccccaaccagagtgacctgattgagcaggctgccgagatgctttatgga ttgatccacgcccgctacatccttaccaaccgtggcatcgcccagatgttggaaaagtac cagcagggagactttggttactgtcctcgtgtgtactgtgagaaccagccaatgcttccc atcggcctttcagacatcccaggtgaagccatggtgaagctctactgccccaagtgcatg gatgtgtacacacccaagtcatcgagacaccatcacacggatggcgcctactttggcact ggtttccctcacatgctcttcatggtgcatcccgagtaccggcccaagagacccgccaac cagtttgtgcccaggctctacggtttcaagattcatccaatggcctaccagctgcagctc caagccgccagcaacttcaagagcccagtcaagacgattcgctga

DBGET integrated database retrieval system