Chlorocebus sabaeus (green monkey): 103222015 Help Entry 103222015         CDS       T04361                                  Name (RefSeq) histone H2B type 1   KO K11252   histone H2B Organism csab  Chlorocebus sabaeus (green monkey) Pathway csab04613   Neutrophil extracellular trap formation csab05034   Alcoholism csab05203   Viral carcinogenesis csab05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:csab00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     103222015  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     103222015   09163 Immune disease    05322 Systemic lupus erythematosus     103222015   09165 Substance dependence    05034 Alcoholism     103222015  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:csab03036]     103222015   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:csab04147]     103222015 Chromosome and associated proteins [BR:csab03036]  Eukaryotic type   Nucleosome assembly factors    Histones     103222015 Exosome [BR:csab04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    103222015 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CBFD_NFYB_HMF YscO-like TFIID_20kDa Motif Other DBs NCBI-GeneID:  103222015 NCBI-ProteinID:  XP_007971675 Ensembl:  ENSCSAG00000019094 UniProt:  A0A0D9SCL5 LinkDB All DBs Position 17:46132568..46133409 Genome browser AA seq 126 aa AA seqDB search MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAM GIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT KYTSSK NT seq 381 nt NT seq  +upstreamnt  +downstreamnt atgcctgagccagccaagtctgctcccgccccgaagaagggctccaagaaggcggtgacc aaggcgcagaaaaaagatgggaaaaagcgcaagcgcagccgcaaggagagctactctgtt tatgtgtacaaggtgctgaagcaggtccaccccgacaccggcatctcttccaaggcgatg gggatcatgaattctttcgttaacgacatatttgagcgtatcgcgggggaggcttcccgc ctggcgcattacaacaagcgctcgaccatcacctccagggagatacagaccgccgtgcgc ttgctccttcccggagagctggccaagcacgccgtgtcggagggcaccaaggccgtcacc aagtacaccagctccaagtaa

DBGET integrated database retrieval system