Chlorocebus sabaeus (green monkey): 103222703 Help Entry 103222703         CDS       T04361                                  Symbol MYL12A Name (RefSeq) myosin light chain 12A   KO K12757   myosin regulatory light chain 12 Organism csab  Chlorocebus sabaeus (green monkey) Pathway csab04360   Axon guidance csab04510   Focal adhesion csab04517   IgSF CAM signaling csab04520   Adherens junction csab04530   Tight junction csab04611   Platelet activation csab04670   Leukocyte transendothelial migration csab04810   Regulation of actin cytoskeleton csab04814   Motor proteins csab05132   Salmonella infection Brite KEGG Orthology (KO) [BR:csab00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     103222703 (MYL12A)  09140 Cellular Processes   09144 Cellular community - eukaryotes    04510 Focal adhesion     103222703 (MYL12A)    04520 Adherens junction     103222703 (MYL12A)    04530 Tight junction     103222703 (MYL12A)   09142 Cell motility    04814 Motor proteins     103222703 (MYL12A)    04810 Regulation of actin cytoskeleton     103222703 (MYL12A)  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     103222703 (MYL12A)    04670 Leukocyte transendothelial migration     103222703 (MYL12A)   09158 Development and regeneration    04360 Axon guidance     103222703 (MYL12A)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     103222703 (MYL12A)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:csab04812]     103222703 (MYL12A)    04147 Exosome [BR:csab04147]     103222703 (MYL12A) Cytoskeleton proteins [BR:csab04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Myosins      103222703 (MYL12A) Exosome [BR:csab04147]  Exosomal proteins   Exosomal proteins of bladder cancer cells    103222703 (MYL12A) SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_7 EF-hand_1 EF-hand_6 AIF-1 EF-hand_11 CFAP251_C EF-hand_5 EF-hand_8 EF-hand_9 EF_EFCAB10_C EF-hand_FSTL1 EF-hand_EFHB_C SPARC_Ca_bdg EAD7 WHD_2nd_Lhr POTRA-like Motif Other DBs NCBI-GeneID:  103222703 NCBI-ProteinID:  XP_007972723 Ensembl:  ENSCSAG00000017601 LinkDB All DBs Position 18:62496372..62504835 Genome browser AA seq 177 aa AA seqDB search MDLTTTMSSKRAKTKTKKRPQRATSNVFAMFDQSQIQEFKEAFNMIDQNRDGFIDKEDLH DMLASLGKNPTDEYLDAMMNEAPGPINFTMFLTMFGEKLNGTDPEDVIRNAFACFDEEAT GTIQEDYLRELLTTMGDRFTDEEVDELYREAPIDKKGNFNYIEFTRILKHGAKDKDD NT seq 534 nt NT seq  +upstreamnt  +downstreamnt atggacttaaccaccaccatgtcaagcaaaagagcaaagaccaagaccaagaagcgccct cagcgcgcaacatccaatgtgtttgccatgtttgaccagtcacagattcaggagttcaaa gaggccttcaacatgattgatcagaacagagatggcttcatcgacaaggaagatttgcat gatatgcttgcttcattggggaagaatccaactgatgagtatctggatgccatgatgaat gaggctccaggccccatcaatttcaccatgttccttaccatgtttggtgagaagttaaat ggcacagatcctgaagatgtcatcagaaatgcttttgcttgctttgatgaagaagcaact ggcaccattcaggaagattacctgagagagctgctgacaaccatgggggatcggtttacg gatgaggaagtggatgagctgtacagagaagcacctattgacaaaaaggggaatttcaat tacatcgagttcacgcgcatcctgaaacacggagcaaaagacaaagatgactga

DBGET integrated database retrieval system