KEGG   Chlorocebus sabaeus (green monkey): 103224167
Entry
103224167         CDS       T04361                                 
Symbol
NRAS
Name
(RefSeq) neuroblastoma RAS viral oncogene homolog
  KO
K07828  GTPase NRas
Organism
csab  Chlorocebus sabaeus (green monkey)
Pathway
csab01521  EGFR tyrosine kinase inhibitor resistance
csab01522  Endocrine resistance
csab04010  MAPK signaling pathway
csab04012  ErbB signaling pathway
csab04014  Ras signaling pathway
csab04015  Rap1 signaling pathway
csab04062  Chemokine signaling pathway
csab04068  FoxO signaling pathway
csab04071  Sphingolipid signaling pathway
csab04072  Phospholipase D signaling pathway
csab04137  Mitophagy - animal
csab04140  Autophagy - animal
csab04150  mTOR signaling pathway
csab04151  PI3K-Akt signaling pathway
csab04210  Apoptosis
csab04211  Longevity regulating pathway
csab04213  Longevity regulating pathway - multiple species
csab04218  Cellular senescence
csab04360  Axon guidance
csab04370  VEGF signaling pathway
csab04371  Apelin signaling pathway
csab04540  Gap junction
csab04550  Signaling pathways regulating pluripotency of stem cells
csab04625  C-type lectin receptor signaling pathway
csab04650  Natural killer cell mediated cytotoxicity
csab04660  T cell receptor signaling pathway
csab04662  B cell receptor signaling pathway
csab04664  Fc epsilon RI signaling pathway
csab04714  Thermogenesis
csab04720  Long-term potentiation
csab04722  Neurotrophin signaling pathway
csab04725  Cholinergic synapse
csab04726  Serotonergic synapse
csab04730  Long-term depression
csab04810  Regulation of actin cytoskeleton
csab04910  Insulin signaling pathway
csab04912  GnRH signaling pathway
csab04915  Estrogen signaling pathway
csab04916  Melanogenesis
csab04917  Prolactin signaling pathway
csab04919  Thyroid hormone signaling pathway
csab04921  Oxytocin signaling pathway
csab04926  Relaxin signaling pathway
csab04929  GnRH secretion
csab04933  AGE-RAGE signaling pathway in diabetic complications
csab04935  Growth hormone synthesis, secretion and action
csab05010  Alzheimer disease
csab05022  Pathways of neurodegeneration - multiple diseases
csab05034  Alcoholism
csab05160  Hepatitis C
csab05161  Hepatitis B
csab05163  Human cytomegalovirus infection
csab05165  Human papillomavirus infection
csab05166  Human T-cell leukemia virus 1 infection
csab05167  Kaposi sarcoma-associated herpesvirus infection
csab05170  Human immunodeficiency virus 1 infection
csab05200  Pathways in cancer
csab05203  Viral carcinogenesis
csab05205  Proteoglycans in cancer
csab05206  MicroRNAs in cancer
csab05207  Chemical carcinogenesis - receptor activation
csab05208  Chemical carcinogenesis - reactive oxygen species
csab05210  Colorectal cancer
csab05211  Renal cell carcinoma
csab05213  Endometrial cancer
csab05214  Glioma
csab05215  Prostate cancer
csab05216  Thyroid cancer
csab05218  Melanoma
csab05219  Bladder cancer
csab05220  Chronic myeloid leukemia
csab05221  Acute myeloid leukemia
csab05223  Non-small cell lung cancer
csab05224  Breast cancer
csab05225  Hepatocellular carcinoma
csab05226  Gastric cancer
csab05230  Central carbon metabolism in cancer
csab05231  Choline metabolism in cancer
csab05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
csab05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:csab00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103224167 (NRAS)
   04012 ErbB signaling pathway
    103224167 (NRAS)
   04014 Ras signaling pathway
    103224167 (NRAS)
   04015 Rap1 signaling pathway
    103224167 (NRAS)
   04370 VEGF signaling pathway
    103224167 (NRAS)
   04371 Apelin signaling pathway
    103224167 (NRAS)
   04068 FoxO signaling pathway
    103224167 (NRAS)
   04072 Phospholipase D signaling pathway
    103224167 (NRAS)
   04071 Sphingolipid signaling pathway
    103224167 (NRAS)
   04151 PI3K-Akt signaling pathway
    103224167 (NRAS)
   04150 mTOR signaling pathway
    103224167 (NRAS)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    103224167 (NRAS)
   04137 Mitophagy - animal
    103224167 (NRAS)
  09143 Cell growth and death
   04210 Apoptosis
    103224167 (NRAS)
   04218 Cellular senescence
    103224167 (NRAS)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    103224167 (NRAS)
   04550 Signaling pathways regulating pluripotency of stem cells
    103224167 (NRAS)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103224167 (NRAS)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    103224167 (NRAS)
   04650 Natural killer cell mediated cytotoxicity
    103224167 (NRAS)
   04660 T cell receptor signaling pathway
    103224167 (NRAS)
   04662 B cell receptor signaling pathway
    103224167 (NRAS)
   04664 Fc epsilon RI signaling pathway
    103224167 (NRAS)
   04062 Chemokine signaling pathway
    103224167 (NRAS)
  09152 Endocrine system
   04910 Insulin signaling pathway
    103224167 (NRAS)
   04929 GnRH secretion
    103224167 (NRAS)
   04912 GnRH signaling pathway
    103224167 (NRAS)
   04915 Estrogen signaling pathway
    103224167 (NRAS)
   04917 Prolactin signaling pathway
    103224167 (NRAS)
   04921 Oxytocin signaling pathway
    103224167 (NRAS)
   04926 Relaxin signaling pathway
    103224167 (NRAS)
   04935 Growth hormone synthesis, secretion and action
    103224167 (NRAS)
   04919 Thyroid hormone signaling pathway
    103224167 (NRAS)
   04916 Melanogenesis
    103224167 (NRAS)
  09156 Nervous system
   04725 Cholinergic synapse
    103224167 (NRAS)
   04726 Serotonergic synapse
    103224167 (NRAS)
   04720 Long-term potentiation
    103224167 (NRAS)
   04730 Long-term depression
    103224167 (NRAS)
   04722 Neurotrophin signaling pathway
    103224167 (NRAS)
  09158 Development and regeneration
   04360 Axon guidance
    103224167 (NRAS)
  09149 Aging
   04211 Longevity regulating pathway
    103224167 (NRAS)
   04213 Longevity regulating pathway - multiple species
    103224167 (NRAS)
  09159 Environmental adaptation
   04714 Thermogenesis
    103224167 (NRAS)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103224167 (NRAS)
   05206 MicroRNAs in cancer
    103224167 (NRAS)
   05205 Proteoglycans in cancer
    103224167 (NRAS)
   05207 Chemical carcinogenesis - receptor activation
    103224167 (NRAS)
   05208 Chemical carcinogenesis - reactive oxygen species
    103224167 (NRAS)
   05203 Viral carcinogenesis
    103224167 (NRAS)
   05230 Central carbon metabolism in cancer
    103224167 (NRAS)
   05231 Choline metabolism in cancer
    103224167 (NRAS)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    103224167 (NRAS)
  09162 Cancer: specific types
   05210 Colorectal cancer
    103224167 (NRAS)
   05225 Hepatocellular carcinoma
    103224167 (NRAS)
   05226 Gastric cancer
    103224167 (NRAS)
   05214 Glioma
    103224167 (NRAS)
   05216 Thyroid cancer
    103224167 (NRAS)
   05221 Acute myeloid leukemia
    103224167 (NRAS)
   05220 Chronic myeloid leukemia
    103224167 (NRAS)
   05218 Melanoma
    103224167 (NRAS)
   05211 Renal cell carcinoma
    103224167 (NRAS)
   05219 Bladder cancer
    103224167 (NRAS)
   05215 Prostate cancer
    103224167 (NRAS)
   05213 Endometrial cancer
    103224167 (NRAS)
   05224 Breast cancer
    103224167 (NRAS)
   05223 Non-small cell lung cancer
    103224167 (NRAS)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103224167 (NRAS)
   05170 Human immunodeficiency virus 1 infection
    103224167 (NRAS)
   05161 Hepatitis B
    103224167 (NRAS)
   05160 Hepatitis C
    103224167 (NRAS)
   05163 Human cytomegalovirus infection
    103224167 (NRAS)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103224167 (NRAS)
   05165 Human papillomavirus infection
    103224167 (NRAS)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103224167 (NRAS)
   05022 Pathways of neurodegeneration - multiple diseases
    103224167 (NRAS)
  09165 Substance dependence
   05034 Alcoholism
    103224167 (NRAS)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    103224167 (NRAS)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    103224167 (NRAS)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    103224167 (NRAS)
   01522 Endocrine resistance
    103224167 (NRAS)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:csab04131]
    103224167 (NRAS)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:csab04147]
    103224167 (NRAS)
   04031 GTP-binding proteins [BR:csab04031]
    103224167 (NRAS)
Membrane trafficking [BR:csab04131]
 Exocytosis
  Small GTPases and associated proteins
   Other small GTPases and associated proteins
    103224167 (NRAS)
 Endocytosis
  Macropinocytosis
   Ras GTPases
    103224167 (NRAS)
Exosome [BR:csab04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   103224167 (NRAS)
  Exosomal proteins of other body fluids (saliva and urine)
   103224167 (NRAS)
  Exosomal proteins of breast cancer cells
   103224167 (NRAS)
  Exosomal proteins of colorectal cancer cells
   103224167 (NRAS)
GTP-binding proteins [BR:csab04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    103224167 (NRAS)
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N Septin Ldh_1_N
Other DBs
NCBI-GeneID: 103224167
NCBI-ProteinID: XP_007975659
Ensembl: ENSCSAG00000001656
UniProt: A0A0D9S680
LinkDB
Position
20:18953273..18966002
AA seq 189 aa
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG
QEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDL
PTRTVDTKQAHELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLNSSDDGTQG
CMGLPCVVM
NT seq 570 nt   +upstreamnt  +downstreamnt
atgactgagtacaaactggtggtggttggagcaggtggtgttgggaaaagcgcactgaca
atccagctaatccagaaccactttgtagatgaatatgatcccaccatagaggattcttac
agaaaacaggtggttatagatggtgaaacctgtttgttggacatactggatacagctgga
caagaagagtacagtgccatgagagaccaatacatgaggacaggcgaaggcttcctctgt
gtatttgccatcaataatagcaagtcatttgcggatattaacctctacagggagcagatt
aagcgagtaaaagactcagatgatgtacctatggtgctagtgggaaacaagtgtgatttg
ccaacaaggacagttgatacaaaacaagcccacgaactggccaagagttacgggattcca
ttcattgaaacctcagccaagaccagacagggtgttgaagatgctttttacacactggta
agagaaatacgccagtaccgaatgaaaaaactcaacagcagtgatgatgggactcagggt
tgtatgggattgccatgtgtggtgatgtaa

DBGET integrated database retrieval system