Chlorocebus sabaeus (green monkey): 103226351 Help Entry 103226351         CDS       T04361                                  Name (RefSeq) ubiquitin-like   KO K02927   ubiquitin-large subunit ribosomal protein L40e Organism csab  Chlorocebus sabaeus (green monkey) Pathway csab03010   Ribosome csab04120   Ubiquitin mediated proteolysis csab04137   Mitophagy - animal csab04140   Autophagy - animal csab05012   Parkinson disease csab05022   Pathways of neurodegeneration - multiple diseases csab05167   Kaposi sarcoma-associated herpesvirus infection csab05171   Coronavirus disease - COVID-19 Brite KEGG Orthology (KO) [BR:csab00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     103226351   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     103226351  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     103226351    04137 Mitophagy - animal     103226351  09160 Human Diseases   09172 Infectious disease: viral    05171 Coronavirus disease - COVID-19     103226351    05167 Kaposi sarcoma-associated herpesvirus infection     103226351   09164 Neurodegenerative disease    05012 Parkinson disease     103226351    05022 Pathways of neurodegeneration - multiple diseases     103226351  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:csab03011]     103226351    04121 Ubiquitin system [BR:csab04121]     103226351 Ribosome [BR:csab03011]  Ribosomal proteins   Eukaryotes    Large subunit     103226351   Archaea     103226351 Ubiquitin system [BR:csab04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    103226351 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin Ribosomal_L40e Rad60-SLD TBK1_ULD Motif Other DBs NCBI-GeneID:  103226351 NCBI-ProteinID:  XP_007980030 LinkDB All DBs Position 21:32667388..32669810 Genome browser AA seq 127 aa AA seqDB search MQIFVKTLTGKTITLEVKPSDTTENVKAKIQAKEGIPLDQQCLIFAGKQLEDGRTLSDCN IQKESILHLGLHLQGGIIEPSLRQLAQKYNYGKMICRKCCARLHPCAVNSHKKCSHTSNL CPKKKVK NT seq 384 nt NT seq  +upstreamnt  +downstreamnt atgcagatctttgtgaagaccctcacaggcaagaccatcaccctcgaggtcaagcccagt gacaccactgagaatgtcaaggccaaaattcaagccaaggagggcatcccacttgaccaa cagtgtctgatatttgcaggcaaacagctggaggatggccgcactctctcagactgcaac atccagaaagagtccatcctgcacctggggctgcacctacaaggtggcattattgagcct tccctccgccagcttgcccagaaatacaactacggcaagatgatctgccgcaagtgctgt gctcgcctgcacccctgtgctgtcaactcccacaagaagtgcagccacaccagcaacctg tgccccaagaagaaggtcaaataa

DBGET integrated database retrieval system