Chlorocebus sabaeus (green monkey): 103226366 Help Entry 103226366         CDS       T04361                                  Symbol NPY Name (RefSeq) neuropeptide Y   KO K05232   neuropeptide Y Organism csab  Chlorocebus sabaeus (green monkey) Pathway csab04024   cAMP signaling pathway csab04080   Neuroactive ligand-receptor interaction csab04920   Adipocytokine signaling pathway csab04923   Regulation of lipolysis in adipocytes csab05034   Alcoholism Brite KEGG Orthology (KO) [BR:csab00001]  09130 Environmental Information Processing   09132 Signal transduction    04024 cAMP signaling pathway     103226366 (NPY)   09133 Signaling molecules and interaction    04080 Neuroactive ligand-receptor interaction     103226366 (NPY)  09150 Organismal Systems   09152 Endocrine system    04923 Regulation of lipolysis in adipocytes     103226366 (NPY)    04920 Adipocytokine signaling pathway     103226366 (NPY)  09160 Human Diseases   09165 Substance dependence    05034 Alcoholism     103226366 (NPY)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:csab04052]     103226366 (NPY) Cytokines and neuropeptides [BR:csab04052]  Neuropeptides   GPCR binding    103226366 (NPY) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Hormone_3 LURY1 Motif Other DBs NCBI-GeneID:  103226366 NCBI-ProteinID:  XP_007980061 Ensembl:  ENSCSAG00000014088 UniProt:  A0A0M3KL75 LinkDB All DBs Position 21:complement(34068533..34076205) Genome browser AA seq 97 aa AA seqDB search MLGSKRLGLSGLTLALSLLVCLGALAEAYPSKPDNPGEDAPAEDMARYYSALRHYINLIT RQRYGKRSSPETLISDLLMRESTENVPRTRLEDPSMW NT seq 294 nt NT seq  +upstreamnt  +downstreamnt atgctaggtagcaagcgactggggctgtccggactgaccctcgccctgtccctgctcgtg tgcctgggtgcgctggccgaggcgtacccctccaaaccggacaacccgggcgaggacgcg ccagcggaggacatggccagatactactcggcgctgcgacactacatcaacctcatcacc aggcagaggtatggcaaacgatctagcccagagacactgatttcagacctcttgatgaga gaaagcacagaaaatgttcccagaactcggcttgaagacccttcaatgtggtga

DBGET integrated database retrieval system