Chlorocebus sabaeus (green monkey): 103226491 Help Entry 103226491         CDS       T04361                                  Symbol RPA3 Name (RefSeq) replication protein A3   KO K10740   replication factor A3 Organism csab  Chlorocebus sabaeus (green monkey) Pathway csab03030   DNA replication csab03420   Nucleotide excision repair csab03430   Mismatch repair csab03440   Homologous recombination csab03460   Fanconi anemia pathway Brite KEGG Orthology (KO) [BR:csab00001]  09120 Genetic Information Processing   09124 Replication and repair    03030 DNA replication     103226491 (RPA3)    03420 Nucleotide excision repair     103226491 (RPA3)    03430 Mismatch repair     103226491 (RPA3)    03440 Homologous recombination     103226491 (RPA3)    03460 Fanconi anemia pathway     103226491 (RPA3)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:csab03032]     103226491 (RPA3)    03400 DNA repair and recombination proteins [BR:csab03400]     103226491 (RPA3) DNA replication proteins [BR:csab03032]  Eukaryotic type   DNA Replication Elongation Factors    RPA (replication protein A)     103226491 (RPA3) DNA repair and recombination proteins [BR:csab03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     RPA (replication factor A)      103226491 (RPA3)    MMR (mismatch excision repair)      103226491 (RPA3)   DSBR (double strand breaks repair)    HR (homologous recombination)      103226491 (RPA3) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Rep_fac-A_3 DUF356 Motif Other DBs NCBI-GeneID:  103226491 NCBI-ProteinID:  XP_007980256 Ensembl:  ENSCSAG00000013124 UniProt:  A0A0D9RL03 LinkDB All DBs Position 21:50570027..50574270 Genome browser AA seq 121 aa AA seqDB search MVDMMELPRSRINAGMLAQFIDKPVCFVGRLEKIHPTGKMFILSDGEGKNGTIELMEPLD EEISGIMEVVGKVTAKATILCTSYVQFKEDNHPFDLGLYNEAVKIIHEFPQFYPLGIVQH D NT seq 366 nt NT seq  +upstreamnt  +downstreamnt atggtggacatgatggagttaccgaggtcgcgcatcaacgccggcatgctagctcagttc atcgacaagcctgtctgcttcgtagggaggctggaaaagattcatcccactggaaaaatg tttattctttcagatggagaaggaaaaaatggaaccatcgagttgatggaaccccttgat gaagaaatctctggaattatggaagtggttggaaaagtaaccgccaaggccaccatcttg tgtacatcttatgtccagtttaaagaagataaccatccttttgatcttggactttacaat gaagctgtgaaaattatccatgagttccctcagttttatcctttagggattgtgcaacat gattga

DBGET integrated database retrieval system