Chlorocebus sabaeus (green monkey): 103226961 Help Entry 103226961         CDS       T04361                                  Symbol ELOB, TCEB2 Name (RefSeq) elongin B   KO K03873   elongin-B Organism csab  Chlorocebus sabaeus (green monkey) Pathway csab04066   HIF-1 signaling pathway csab04120   Ubiquitin mediated proteolysis csab05170   Human immunodeficiency virus 1 infection csab05200   Pathways in cancer csab05211   Renal cell carcinoma Brite KEGG Orthology (KO) [BR:csab00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     103226961 (ELOB)  09130 Environmental Information Processing   09132 Signal transduction    04066 HIF-1 signaling pathway     103226961 (ELOB)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     103226961 (ELOB)   09162 Cancer: specific types    05211 Renal cell carcinoma     103226961 (ELOB)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     103226961 (ELOB)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:csab04121]     103226961 (ELOB)    03400 DNA repair and recombination proteins [BR:csab03400]     103226961 (ELOB) Ubiquitin system [BR:csab04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      103226961 (ELOB)    Cul5 complex      103226961 (ELOB) DNA repair and recombination proteins [BR:csab03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      103226961 (ELOB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin Rad60-SLD Motif Other DBs NCBI-GeneID:  103226961 NCBI-ProteinID:  XP_007981230 Ensembl:  ENSCSAG00000010372 LinkDB All DBs Position 5:2564662..2570035 Genome browser AA seq 118 aa AA seqDB search MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGEC GFTSQTARPQAPATVGLAFRAEDTFEALCIEPFSSPPELPDVMKPQDSGSSANEQAVQ NT seq 357 nt NT seq  +upstreamnt  +downstreamnt atggacgtgttcctcatgatccggcgccacaagaccaccatcttcacggacgccaaggag tccagcacggtgttcgagctgaagcgcatcgtcgagggcatcctcaagcggcctcctgac gagcagcggctgtacaaggatgaccaactcttggatgatggcaagaccctgggcgagtgt ggtttcaccagtcaaacagcacggccacaggccccagccacagtggggctggccttccgg gcagaggacacctttgaggccctgtgcattgagccgttctccagcccacctgagctgccc gatgtgatgaagccccaggactcgggaagcagtgccaatgaacaagccgtgcagtga

DBGET integrated database retrieval system