Chlorocebus sabaeus (green monkey): 103227080 Help Entry 103227080         CDS       T04361                                  Name (RefSeq) uncharacterized LOC103227080   KO K10785   T-cell receptor beta chain V region Organism csab  Chlorocebus sabaeus (green monkey) Pathway csab04014   Ras signaling pathway csab04015   Rap1 signaling pathway csab04020   Calcium signaling pathway csab04064   NF-kappa B signaling pathway csab04514   Cell adhesion molecule (CAM) interaction csab04612   Antigen processing and presentation csab04658   Th1 and Th2 cell differentiation csab04659   Th17 cell differentiation csab04660   T cell receptor signaling pathway csab04672   Intestinal immune network for IgA production csab04940   Type I diabetes mellitus csab05135   Yersinia infection csab05142   Chagas disease csab05144   Malaria csab05150   Staphylococcus aureus infection csab05162   Measles csab05166   Human T-cell leukemia virus 1 infection csab05169   Epstein-Barr virus infection csab05170   Human immunodeficiency virus 1 infection csab05202   Transcriptional misregulation in cancer csab05235   PD-L1 expression and PD-1 checkpoint pathway in cancer csab05310   Asthma csab05320   Autoimmune thyroid disease csab05321   Inflammatory bowel disease csab05322   Systemic lupus erythematosus csab05323   Rheumatoid arthritis csab05330   Allograft rejection csab05332   Graft-versus-host disease csab05416   Viral myocarditis Brite KEGG Orthology (KO) [BR:csab00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     103227080    04015 Rap1 signaling pathway     103227080    04064 NF-kappa B signaling pathway     103227080    04020 Calcium signaling pathway     103227080   09133 Signaling molecules and interaction    04514 Cell adhesion molecule (CAM) interaction     103227080  09150 Organismal Systems   09151 Immune system    04612 Antigen processing and presentation     103227080    04660 T cell receptor signaling pathway     103227080    04658 Th1 and Th2 cell differentiation     103227080    04659 Th17 cell differentiation     103227080    04672 Intestinal immune network for IgA production     103227080  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     103227080    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     103227080   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     103227080    05170 Human immunodeficiency virus 1 infection     103227080    05162 Measles     103227080    05169 Epstein-Barr virus infection     103227080   09171 Infectious disease: bacterial    05135 Yersinia infection     103227080    05150 Staphylococcus aureus infection     103227080   09174 Infectious disease: parasitic    05144 Malaria     103227080    05142 Chagas disease     103227080   09163 Immune disease    05310 Asthma     103227080    05322 Systemic lupus erythematosus     103227080    05323 Rheumatoid arthritis     103227080    05320 Autoimmune thyroid disease     103227080    05321 Inflammatory bowel disease     103227080    05330 Allograft rejection     103227080    05332 Graft-versus-host disease     103227080   09166 Cardiovascular disease    05416 Viral myocarditis     103227080   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     103227080 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  V-set Ig_3 Motif Other DBs NCBI-GeneID:  103227080 NCBI-ProteinID:  XP_007981417 LinkDB All DBs Position 21:111375246..111377182 Genome browser AA seq 243 aa AA seqDB search MRSWPGPEMGTRFFFYVALCLLWTGHMDARITQSPRHKITETGTPVTLRCHQTENHRYMY WYRQDLGHGLRLIHYSYGVEDTDKVEVSDGYSVSRSKTEDFLLTLESATRSQTSVYLCAS SEPTVLHSCLLSARKGQLERLRLLCVCPHPGQSRPPQESESPGQPGGHRAGALGPSVLTS IPTPVSNQLEVTPTPLACLVSLLQLFFFFFFSAFRKEKASLVEISDNSLNPKAWTSSLTC GLQ NT seq 732 nt NT seq  +upstreamnt  +downstreamnt atgagatcctggcctggacctgaaatgggcacaaggttcttcttctatgtggccctttgt ctcctgtggacaggacacatggatgctagaatcacccagagcccaagacacaagatcaca gagacaggaacaccagtgactctgagatgtcaccagactgagaaccaccgctatatgtac tggtatcgacaagacctggggcatgggctgaggctgatccattactcatatggtgttgaa gacactgacaaagtagaagtctcagatggctacagtgtctctagatcaaagacagaggat ttcctcctcactctggagtccgctacccgctcccagacatctgtgtacctttgtgccagc agtgaacccacagtgctgcacagctgcctcctctctgcacgtaaagggcagttagaaaga ctgaggttgctctgtgtctgtccccaccccgggcagtccaggcctccacaggagtcagag agccctggccagcctggaggccatagagcaggggccttaggaccctcagtgctgacgtcc attcctaccccagtctcaaaccaactggaggtcaccccaacacccttagcttgcctagtc tctcttctgcagctgtttttttttttttttttttctgcttttagaaaggaaaaggcatca ctagttgagattagtgataattctcttaaccccaaagcctggacttcttctctcacctgt gggcttcagtga

DBGET integrated database retrieval system