Chlorocebus sabaeus (green monkey): 103227095 Help Entry 103227095         CDS       T04361                                  Name (RefSeq) uncharacterized LOC103227095   KO K10785   T-cell receptor beta chain V region Organism csab  Chlorocebus sabaeus (green monkey) Pathway csab04014   Ras signaling pathway csab04015   Rap1 signaling pathway csab04020   Calcium signaling pathway csab04064   NF-kappa B signaling pathway csab04514   Cell adhesion molecules csab04612   Antigen processing and presentation csab04658   Th1 and Th2 cell differentiation csab04659   Th17 cell differentiation csab04660   T cell receptor signaling pathway csab04672   Intestinal immune network for IgA production csab04940   Type I diabetes mellitus csab05135   Yersinia infection csab05142   Chagas disease csab05144   Malaria csab05150   Staphylococcus aureus infection csab05162   Measles csab05166   Human T-cell leukemia virus 1 infection csab05169   Epstein-Barr virus infection csab05170   Human immunodeficiency virus 1 infection csab05202   Transcriptional misregulation in cancer csab05235   PD-L1 expression and PD-1 checkpoint pathway in cancer csab05310   Asthma csab05320   Autoimmune thyroid disease csab05321   Inflammatory bowel disease csab05322   Systemic lupus erythematosus csab05323   Rheumatoid arthritis csab05330   Allograft rejection csab05332   Graft-versus-host disease csab05416   Viral myocarditis Brite KEGG Orthology (KO) [BR:csab00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     103227095    04015 Rap1 signaling pathway     103227095    04064 NF-kappa B signaling pathway     103227095    04020 Calcium signaling pathway     103227095   09133 Signaling molecules and interaction    04514 Cell adhesion molecules     103227095  09150 Organismal Systems   09151 Immune system    04612 Antigen processing and presentation     103227095    04660 T cell receptor signaling pathway     103227095    04658 Th1 and Th2 cell differentiation     103227095    04659 Th17 cell differentiation     103227095    04672 Intestinal immune network for IgA production     103227095  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     103227095    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     103227095   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     103227095    05170 Human immunodeficiency virus 1 infection     103227095    05162 Measles     103227095    05169 Epstein-Barr virus infection     103227095   09171 Infectious disease: bacterial    05135 Yersinia infection     103227095    05150 Staphylococcus aureus infection     103227095   09174 Infectious disease: parasitic    05144 Malaria     103227095    05142 Chagas disease     103227095   09163 Immune disease    05310 Asthma     103227095    05322 Systemic lupus erythematosus     103227095    05323 Rheumatoid arthritis     103227095    05320 Autoimmune thyroid disease     103227095    05321 Inflammatory bowel disease     103227095    05330 Allograft rejection     103227095    05332 Graft-versus-host disease     103227095   09166 Cardiovascular disease    05416 Viral myocarditis     103227095   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     103227095 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  V-set Ig_2 Ig_3 Motif Other DBs NCBI-GeneID:  103227095 NCBI-ProteinID:  XP_007981421 LinkDB All DBs Position 21:111227181..111230752 Genome browser AA seq 275 aa AA seqDB search MCSSHSQLFTGAFILDLTIWGRGVASPGLSLPGAQAGRMRSQNDSLDSPVPVSSMHRPRR PLRHAASTMSISILCCAAFCLLWAGPVNAGVTQTPKFQVLKTGQSMTLQCAQDMNHDCMY WYRQDPGMGLRLIHYSFGKGSTDKGEVPDGYNVTRSSTEDFTLRLESAAPSQTSVYFCAS SYSTALQGCLLSAHKARQALPSSLTQDSGMPWAEFSTPGSLEPRVTPSGPGSMSLALCQV PLQAVSARPGLVPGPQMSLLLLCLFFSQSSPFGVG NT seq 828 nt NT seq  +upstreamnt  +downstreamnt atgtgttcttctcattctcagctgttcactggtgcatttattttggatttgaccatctgg ggaagaggcgtggcctctcctggcctctccctccctggggcccaggcagggagaatgagg tctcagaatgactcccttgacagtcctgttcccgtttcatcaatgcacagacccagaaga cccctccgtcatgcagcatctaccatgagcatcagcatcctgtgctgcgcagccttttgt ctcctgtgggcaggtccagtgaatgctggtgtcactcagaccccaaaattccaggtcctg aaaacaggacagagcatgacactgcagtgtgcccaggatatgaaccatgactgcatgtac tggtatcgacaagacccaggcatggggctgaggctgattcattactcatttggtaaaggt agtactgacaaaggagaagtccccgatggctacaatgtcaccagatcaagcacagaggat ttcacactcagactggagtcggctgctccctcccagacatctgtgtacttctgtgccagc agttactccacagcgttacaaggctgcctcctctctgcacataaagccaggcaggctctg ccctcctccctcacccaagactcagggatgccctgggcagagttctctacaccagggtcc ttggagccccgagtgaccccaagtggcccaggcagtatgagcctcgctctgtgccaggtg cctctgcaggcagtctcagccaggcctggactggtcccaggtcctcagatgtctcttttg ttgctctgtctgttcttttctcagagctctccttttggggtggggtga

DBGET integrated database retrieval system