Chlorocebus sabaeus (green monkey): 103227259 Help Entry 103227259         CDS       T04361                                  Symbol RHEB Name (RefSeq) Ras homolog enriched in brain   KO K07208   Ras homolog enriched in brain Organism csab  Chlorocebus sabaeus (green monkey) Pathway csab04072   Phospholipase D signaling pathway csab04140   Autophagy - animal csab04150   mTOR signaling pathway csab04151   PI3K-Akt signaling pathway csab04152   AMPK signaling pathway csab04211   Longevity regulating pathway csab04218   Cellular senescence csab04714   Thermogenesis csab04910   Insulin signaling pathway csab04919   Thyroid hormone signaling pathway csab05163   Human cytomegalovirus infection csab05165   Human papillomavirus infection csab05168   Herpes simplex virus 1 infection csab05231   Choline metabolism in cancer Brite KEGG Orthology (KO) [BR:csab00001]  09130 Environmental Information Processing   09132 Signal transduction    04072 Phospholipase D signaling pathway     103227259 (RHEB)    04151 PI3K-Akt signaling pathway     103227259 (RHEB)    04152 AMPK signaling pathway     103227259 (RHEB)    04150 mTOR signaling pathway     103227259 (RHEB)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     103227259 (RHEB)   09143 Cell growth and death    04218 Cellular senescence     103227259 (RHEB)  09150 Organismal Systems   09152 Endocrine system    04910 Insulin signaling pathway     103227259 (RHEB)    04919 Thyroid hormone signaling pathway     103227259 (RHEB)   09149 Aging    04211 Longevity regulating pathway     103227259 (RHEB)   09159 Environmental adaptation    04714 Thermogenesis     103227259 (RHEB)  09160 Human Diseases   09161 Cancer: overview    05231 Choline metabolism in cancer     103227259 (RHEB)   09172 Infectious disease: viral    05168 Herpes simplex virus 1 infection     103227259 (RHEB)    05163 Human cytomegalovirus infection     103227259 (RHEB)    05165 Human papillomavirus infection     103227259 (RHEB)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04031 GTP-binding proteins [BR:csab04031]     103227259 (RHEB) GTP-binding proteins [BR:csab04031]  Small (monomeric) G-proteins   Ras Family    Rheb     103227259 (RHEB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU RsgA_GTPase SRPRB AAA_14 RhoGAP_pG1_pG2 DUF1842 Motif Other DBs NCBI-GeneID:  103227259 NCBI-ProteinID:  XP_007981723 Ensembl:  ENSCSAG00000006601 LinkDB All DBs Position 21:complement(119652692..119704833) Genome browser AA seq 184 aa AA seqDB search MPQSKSRKIAILGYRSVGKSSLTIQFVEGQFVDSYDPTIENTFTKLITVNGQEYHLQLVD TAGQDEYSIFPQTYSIDINGYILVYSVTSIKSFEVIKVIHGKLLDMVGKVQIPIMLVGNK KDLHMERVISYEEGKALAESWNAAFLESSAKENQTAVDVFRRIILEAEKMDGAASQGKSS CSVM NT seq 555 nt NT seq  +upstreamnt  +downstreamnt atgccgcagtccaagtcccggaagatcgcgatcctgggctaccggtctgtggggaaatcc tcattgacgattcaatttgttgaaggccaatttgtggactcctacgatccaaccatagaa aacacttttacaaagttgatcacagtaaatggacaagaatatcatcttcaacttgtagac acagctgggcaagatgaatattctatctttcctcagacctactccatagatattaatggc tatattcttgtgtattctgttacatcaatcaaaagttttgaagtgattaaagttatccat ggcaaattattggatatggtggggaaagtacaaatacctattatgttggttgggaataag aaagacctgcatatggaaagggtgatcagttatgaagaagggaaagctttggcagaatct tggaatgcagcttttttggaatcttctgctaaagaaaatcagactgctgttgatgttttt agaaggataattttggaggcagaaaaaatggatggggcagcttcacaaggcaagtcttca tgctcggtgatgtga

DBGET integrated database retrieval system