Chlorocebus sabaeus (green monkey): 103227453 Help Entry 103227453         CDS       T04361                                  Symbol CCK Name (RefSeq) cholecystokinin   KO K05226   cholecystokinin Organism csab  Chlorocebus sabaeus (green monkey) Pathway csab04080   Neuroactive ligand-receptor interaction csab04081   Hormone signaling csab04911   Insulin secretion csab04972   Pancreatic secretion Brite KEGG Orthology (KO) [BR:csab00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04080 Neuroactive ligand-receptor interaction     103227453 (CCK)    04081 Hormone signaling     103227453 (CCK)  09150 Organismal Systems   09152 Endocrine system    04911 Insulin secretion     103227453 (CCK)   09154 Digestive system    04972 Pancreatic secretion     103227453 (CCK)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:csab04052]     103227453 (CCK) Cytokines and neuropeptides [BR:csab04052]  Neuropeptides   GPCR binding    103227453 (CCK) SSDB OrthologParalogGFIT Motif Pfam:  Gastrin PGLa-A Motif Other DBs NCBI-GeneID:  103227453 NCBI-ProteinID:  XP_007981975 Ensembl:  ENSCSAG00000016797 UniProt:  A0A0D9RW62 LinkDB All DBs Position 22 Genome browser AA seq 114 aa AA seqDB search MNSGVRLCVLMAVLAAGALAQPVPPAEPAGSGLQRPEAPRRQLRAVQRTDGESRAHLGAL LARYIQQARKAPSGRMSIIKNLQNLDPSHRISDRDYMGWMDFGRRSAEEYEYPS NT seq 345 nt NT seq  +upstreamnt  +downstreamnt atgaacagcggcgtgcgcctgtgcgtactgatggcggtactggcggctggcgccctggcg cagccggtgcctcccgcagagcccgcgggctccgggctgcagcggccagaggcgccccgt aggcagctgagggcagtgcagagaacggacggggagtcccgagcgcacctgggcgcgctg ctggcgagatacatccagcaggccaggaaagctccttctgggcgaatgtccatcattaag aacctgcagaacctggaccccagccacaggataagtgaccgggactacatgggctggatg gattttggccgtcgcagtgccgaggagtatgagtacccctcctag

DBGET integrated database retrieval system