Chlorocebus sabaeus (green monkey): 103227629 Help Entry 103227629         CDS       T04361                                  Symbol RHOA Name (RefSeq) ras homolog family member A   KO K04513   Ras homolog gene family, member A Organism csab  Chlorocebus sabaeus (green monkey) Pathway csab04014   Ras signaling pathway csab04015   Rap1 signaling pathway csab04022   cGMP-PKG signaling pathway csab04024   cAMP signaling pathway csab04062   Chemokine signaling pathway csab04071   Sphingolipid signaling pathway csab04072   Phospholipase D signaling pathway csab04081   Hormone signaling csab04144   Endocytosis csab04150   mTOR signaling pathway csab04270   Vascular smooth muscle contraction csab04310   Wnt signaling pathway csab04350   TGF-beta signaling pathway csab04360   Axon guidance csab04510   Focal adhesion csab04520   Adherens junction csab04530   Tight junction csab04611   Platelet activation csab04621   NOD-like receptor signaling pathway csab04625   C-type lectin receptor signaling pathway csab04660   T cell receptor signaling pathway csab04670   Leukocyte transendothelial migration csab04722   Neurotrophin signaling pathway csab04810   Regulation of actin cytoskeleton csab04921   Oxytocin signaling pathway csab04928   Parathyroid hormone synthesis, secretion and action csab04972   Pancreatic secretion csab05100   Bacterial invasion of epithelial cells csab05132   Salmonella infection csab05133   Pertussis csab05135   Yersinia infection csab05152   Tuberculosis csab05163   Human cytomegalovirus infection csab05200   Pathways in cancer csab05203   Viral carcinogenesis csab05205   Proteoglycans in cancer csab05206   MicroRNAs in cancer csab05210   Colorectal cancer csab05417   Lipid and atherosclerosis csab05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:csab00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     103227629 (RHOA)    04015 Rap1 signaling pathway     103227629 (RHOA)    04310 Wnt signaling pathway     103227629 (RHOA)    04350 TGF-beta signaling pathway     103227629 (RHOA)    04072 Phospholipase D signaling pathway     103227629 (RHOA)    04071 Sphingolipid signaling pathway     103227629 (RHOA)    04024 cAMP signaling pathway     103227629 (RHOA)    04022 cGMP-PKG signaling pathway     103227629 (RHOA)    04150 mTOR signaling pathway     103227629 (RHOA)   09133 Signaling molecules and interaction    04081 Hormone signaling     103227629 (RHOA)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     103227629 (RHOA)  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     103227629 (RHOA)    04660 T cell receptor signaling pathway     103227629 (RHOA)    04670 Leukocyte transendothelial migration     103227629 (RHOA)    04062 Chemokine signaling pathway     103227629 (RHOA)   09152 Endocrine system    04921 Oxytocin signaling pathway     103227629 (RHOA)    04928 Parathyroid hormone synthesis, secretion and action     103227629 (RHOA)   09154 Digestive system    04972 Pancreatic secretion     103227629 (RHOA)   09156 Nervous system    04722 Neurotrophin signaling pathway     103227629 (RHOA)   09158 Development and regeneration    04360 Axon guidance     103227629 (RHOA)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     103227629 (RHOA)    05206 MicroRNAs in cancer     103227629 (RHOA)    05205 Proteoglycans in cancer     103227629 (RHOA)    05203 Viral carcinogenesis     103227629 (RHOA)   09162 Cancer: specific types    05210 Colorectal cancer     103227629 (RHOA)   09172 Infectious disease: viral    05163 Human cytomegalovirus infection     103227629 (RHOA)   09171 Infectious disease: bacterial    05135 Yersinia infection     103227629 (RHOA)    05133 Pertussis     103227629 (RHOA)    05152 Tuberculosis     103227629 (RHOA)    05100 Bacterial invasion of epithelial cells     103227629 (RHOA)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     103227629 (RHOA)    05418 Fluid shear stress and atherosclerosis     103227629 (RHOA)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:csab04131]     103227629 (RHOA)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:csab04147]     103227629 (RHOA)    04031 GTP-binding proteins [BR:csab04031]     103227629 (RHOA) Membrane trafficking [BR:csab04131]  Endocytosis   Lipid raft mediated endocytosis    RhoA-dependent endocytosis     103227629 (RHOA) Exosome [BR:csab04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    103227629 (RHOA)   Exosomal proteins of other body fluids (saliva and urine)    103227629 (RHOA)   Exosomal proteins of colorectal cancer cells    103227629 (RHOA)   Exosomal proteins of bladder cancer cells    103227629 (RHOA) GTP-binding proteins [BR:csab04031]  Small (monomeric) G-proteins   Rho Family    RhoA/B/C [OT]     103227629 (RHOA) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Gtr1_RagA SRPRB VASP_tetra Motif Other DBs NCBI-GeneID:  103227629 NCBI-ProteinID:  XP_007982413 Ensembl:  ENSCSAG00000015074 UniProt:  A0A0D9RRD7 LinkDB All DBs Position 22:complement(10757381..10809257) Genome browser AA seq 193 aa AA seqDB search MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDT AGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKD LRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQ ARRGKKKSGCLVL NT seq 582 nt NT seq  +upstreamnt  +downstreamnt atggctgccatccggaagaaactagtgattgttggtgatggagcctgtggaaagacatgc ttgctcatagtcttcagcaaggaccagttcccagaggtgtatgtgcccacagtgtttgag aactatgtggcagatatcgaggtggatggaaaacaggtagagttggctttgtgggacaca gctgggcaggaagattatgatcgcctgaggcccctctcctacccagataccgatgttata ctgatgtgtttttccatcgacagccctgatagtttagaaaacatcccagaaaagtggacc ccggaagtcaagcatttctgtcccaacgtgcccatcatcctggttgggaataagaaggat cttcggaatgatgagcacacaaggcgggagctagccaagatgaagcaggagccggtgaaa cctgaagaaggcagagatatggcaaacaggattggtgcttttgggtacatggagtgttca gcaaagaccaaagatggagtgagagaggtttttgaaatggctacgagagctgctctgcaa gctagacgtgggaagaaaaaatctgggtgccttgtcttgtga

DBGET integrated database retrieval system