Entry |
|
Symbol |
GNG2
|
Name |
(RefSeq) G protein subunit gamma 2
|
KO |
K07826 | guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-2 |
|
Organism |
csab Chlorocebus sabaeus (green monkey)
|
Pathway |
csab04723 | Retrograde endocannabinoid signaling |
csab05167 | Kaposi sarcoma-associated herpesvirus infection |
csab05170 | Human immunodeficiency virus 1 infection |
|
Brite |
KEGG Orthology (KO) [BR:csab00001]
09130 Environmental Information Processing
09132 Signal transduction
04014 Ras signaling pathway
103228983 (GNG2)
04371 Apelin signaling pathway
103228983 (GNG2)
04151 PI3K-Akt signaling pathway
103228983 (GNG2)
09133 Signaling molecules and interaction
04082 Neuroactive ligand signaling
103228983 (GNG2)
04081 Hormone signaling
103228983 (GNG2)
09150 Organismal Systems
09151 Immune system
04062 Chemokine signaling pathway
103228983 (GNG2)
09152 Endocrine system
04926 Relaxin signaling pathway
103228983 (GNG2)
09156 Nervous system
04724 Glutamatergic synapse
103228983 (GNG2)
04727 GABAergic synapse
103228983 (GNG2)
04725 Cholinergic synapse
103228983 (GNG2)
04728 Dopaminergic synapse
103228983 (GNG2)
04726 Serotonergic synapse
103228983 (GNG2)
04723 Retrograde endocannabinoid signaling
103228983 (GNG2)
09159 Environmental adaptation
04713 Circadian entrainment
103228983 (GNG2)
09160 Human Diseases
09161 Cancer: overview
05200 Pathways in cancer
103228983 (GNG2)
09172 Infectious disease: viral
05170 Human immunodeficiency virus 1 infection
103228983 (GNG2)
05163 Human cytomegalovirus infection
103228983 (GNG2)
05167 Kaposi sarcoma-associated herpesvirus infection
103228983 (GNG2)
09165 Substance dependence
05032 Morphine addiction
103228983 (GNG2)
05034 Alcoholism
103228983 (GNG2)
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
04147 Exosome [BR:csab04147]
103228983 (GNG2)
04031 GTP-binding proteins [BR:csab04031]
103228983 (GNG2)
Exosome [BR:csab04147]
Exosomal proteins
Exosomal proteins of haemopoietic cells (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
103228983 (GNG2)
GTP-binding proteins [BR:csab04031]
Heterotrimeric G-proteins
Gamma Subunits
Gamma [OT]
103228983 (GNG2)
|
SSDB |
|
Motif |
|
Other DBs |
|
LinkDB |
|
Position |
24:28935885..29069741
|
AA seq |
89 aa
MRIWWKSNVFLKDLSSTPMASNNTASIAQARKLVEQLKMEANIDRIKVSKAAADLMAYCE
AHAKEDPLLTPVPASENPFREKKFFCAIL |
NT seq |
270 nt +upstreamnt +downstreamnt
atgaggatttggtggaaatcaaatgtgtttctgaaagatctatccagcactccgatggcc
agcaacaacaccgccagcatagcacaagccaggaagctggtagagcagcttaagatggaa
gccaacatcgacaggataaaggtgtccaaggcagctgcagatttgatggcctactgtgaa
gcgcatgccaaggaagatcccctcctgacccctgttccggcttcagaaaacccgtttagg
gagaagaagtttttctgtgccatcctttaa |